Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q07915

Protein Details
Accession Q07915    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-62AKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAGKEHydrophilic
177-199EEQLEKQKILLKNRRRNTKKIAFHydrophilic
NLS Segment(s)
PositionSequence
39-59AFKQRRNPRKLKWTKAFRKAA
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0001671  F:ATPase activator activity  
GO:0051117  F:ATPase binding  
GO:1902626  P:assembly of large subunit precursor of preribosome  
GO:0032781  P:positive regulation of ATP-dependent activity  
GO:0042273  P:ribosomal large subunit biogenesis  
KEGG sce:YLR009W  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDFLRDKKLVESNPELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQLEKQKILLKNRRRNTKKIAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.39
4 0.37
5 0.34
6 0.31
7 0.32
8 0.29
9 0.31
10 0.27
11 0.26
12 0.25
13 0.27
14 0.3
15 0.29
16 0.33
17 0.4
18 0.4
19 0.49
20 0.55
21 0.63
22 0.64
23 0.73
24 0.75
25 0.76
26 0.87
27 0.88
28 0.89
29 0.9
30 0.91
31 0.91
32 0.92
33 0.9
34 0.9
35 0.9
36 0.89
37 0.88
38 0.89
39 0.88
40 0.89
41 0.87
42 0.81
43 0.81
44 0.73
45 0.7
46 0.64
47 0.54
48 0.46
49 0.39
50 0.34
51 0.24
52 0.22
53 0.14
54 0.1
55 0.1
56 0.09
57 0.08
58 0.09
59 0.13
60 0.16
61 0.21
62 0.24
63 0.27
64 0.32
65 0.39
66 0.46
67 0.47
68 0.45
69 0.42
70 0.39
71 0.35
72 0.31
73 0.28
74 0.2
75 0.16
76 0.16
77 0.16
78 0.14
79 0.14
80 0.13
81 0.1
82 0.11
83 0.12
84 0.17
85 0.19
86 0.24
87 0.28
88 0.3
89 0.3
90 0.37
91 0.4
92 0.42
93 0.49
94 0.54
95 0.62
96 0.67
97 0.71
98 0.7
99 0.72
100 0.72
101 0.71
102 0.69
103 0.62
104 0.58
105 0.58
106 0.59
107 0.56
108 0.53
109 0.5
110 0.43
111 0.46
112 0.48
113 0.43
114 0.4
115 0.4
116 0.4
117 0.36
118 0.39
119 0.33
120 0.28
121 0.28
122 0.23
123 0.21
124 0.21
125 0.2
126 0.22
127 0.24
128 0.27
129 0.27
130 0.27
131 0.26
132 0.28
133 0.32
134 0.33
135 0.33
136 0.36
137 0.38
138 0.38
139 0.4
140 0.34
141 0.29
142 0.25
143 0.23
144 0.17
145 0.14
146 0.13
147 0.13
148 0.12
149 0.12
150 0.1
151 0.09
152 0.09
153 0.09
154 0.09
155 0.07
156 0.06
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.05
163 0.06
164 0.06
165 0.08
166 0.13
167 0.14
168 0.14
169 0.15
170 0.23
171 0.28
172 0.38
173 0.47
174 0.53
175 0.63
176 0.72
177 0.82
178 0.81
179 0.84