Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CRT9

Protein Details
Accession Q6CRT9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
144-172EEKFDPKLFRKIKVDKRRSKNILFSKANRHydrophilic
NLS Segment(s)
PositionSequence
153-163RKIKVDKRRSK
Subcellular Location(s) nucl 13, mito 11, cyto 2
Family & Domain DBs
KEGG kla:KLLA0_D06479g  -  
Amino Acid Sequences MLSLFPFKLSHSSSSSSKNQQGSSEVKDEFAFKFRETENEFLDIALMGKSKNKSLAKKTELRDQHSCNLTELPRELQEEVDLSVSEMIEFQNHASGRTFVDDKKRLELQQKLDNVRAGYYSRNLEHVPLHQFIPDDYALDSFEEEKFDPKLFRKIKVDKRRSKNILFSKANRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.46
4 0.49
5 0.5
6 0.48
7 0.45
8 0.47
9 0.45
10 0.43
11 0.41
12 0.34
13 0.31
14 0.3
15 0.3
16 0.26
17 0.26
18 0.22
19 0.18
20 0.21
21 0.2
22 0.27
23 0.29
24 0.31
25 0.29
26 0.29
27 0.29
28 0.25
29 0.24
30 0.17
31 0.13
32 0.1
33 0.08
34 0.06
35 0.1
36 0.12
37 0.13
38 0.21
39 0.26
40 0.33
41 0.4
42 0.5
43 0.52
44 0.59
45 0.61
46 0.61
47 0.62
48 0.61
49 0.6
50 0.54
51 0.54
52 0.5
53 0.48
54 0.4
55 0.37
56 0.31
57 0.26
58 0.23
59 0.18
60 0.16
61 0.17
62 0.16
63 0.12
64 0.12
65 0.11
66 0.1
67 0.09
68 0.07
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.07
79 0.08
80 0.09
81 0.09
82 0.1
83 0.11
84 0.13
85 0.14
86 0.12
87 0.21
88 0.26
89 0.27
90 0.3
91 0.33
92 0.34
93 0.39
94 0.43
95 0.4
96 0.42
97 0.46
98 0.44
99 0.44
100 0.43
101 0.37
102 0.31
103 0.27
104 0.21
105 0.17
106 0.18
107 0.19
108 0.17
109 0.19
110 0.19
111 0.19
112 0.2
113 0.22
114 0.24
115 0.22
116 0.22
117 0.2
118 0.2
119 0.18
120 0.2
121 0.16
122 0.13
123 0.12
124 0.12
125 0.11
126 0.11
127 0.12
128 0.09
129 0.09
130 0.11
131 0.11
132 0.13
133 0.14
134 0.16
135 0.2
136 0.23
137 0.33
138 0.34
139 0.41
140 0.49
141 0.57
142 0.66
143 0.73
144 0.8
145 0.8
146 0.86
147 0.9
148 0.88
149 0.85
150 0.85
151 0.84
152 0.83
153 0.81