Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P34164

Protein Details
Accession P34164   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-28GTTTSHPAQKKQTTKKCRAPIMSDVREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR006828  ASC_dom  
IPR037256  ASC_dom_sf  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0031588  C:nucleotide-activated protein kinase complex  
GO:0005634  C:nucleus  
GO:0005886  C:plasma membrane  
GO:0140767  F:enzyme-substrate adaptor activity  
GO:0019901  F:protein kinase binding  
GO:0042149  P:cellular response to glucose starvation  
GO:0030447  P:filamentous growth  
GO:0001403  P:invasive growth in response to glucose limitation  
GO:1904547  P:regulation of cellular response to glucose starvation  
GO:0043254  P:regulation of protein-containing complex assembly  
GO:0007165  P:signal transduction  
KEGG sce:YGL208W  -  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
PF04739  AMPKBI  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MGTTTSHPAQKKQTTKKCRAPIMSDVREKPSNAQGCEPQEMDAVSKKVTELSLNKCSDSQDAGQPSREGSITKKKSTLLLRDEDEPTMPKLSVMETAVDTDSGSSSTSDDEEGDIIAQTTEPKQDASPDDDRSGHSSPREEGQQQIRAKEASGGPSEIKSSLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQPEKNPTNEKIRSKEADSMRPPTSDRSSIALQIGKDPDDFGDGYTRFHEDLSPRPPLEYTTDIPAVFTDPSVMERYYYTLDRQQSNTDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.89
4 0.89
5 0.89
6 0.86
7 0.81
8 0.8
9 0.8
10 0.79
11 0.77
12 0.71
13 0.68
14 0.65
15 0.6
16 0.54
17 0.53
18 0.51
19 0.45
20 0.46
21 0.46
22 0.47
23 0.5
24 0.46
25 0.37
26 0.32
27 0.3
28 0.27
29 0.26
30 0.23
31 0.19
32 0.19
33 0.18
34 0.18
35 0.19
36 0.22
37 0.24
38 0.3
39 0.39
40 0.4
41 0.4
42 0.4
43 0.4
44 0.36
45 0.34
46 0.29
47 0.27
48 0.33
49 0.34
50 0.35
51 0.34
52 0.32
53 0.3
54 0.27
55 0.21
56 0.21
57 0.3
58 0.34
59 0.38
60 0.4
61 0.4
62 0.46
63 0.52
64 0.54
65 0.5
66 0.49
67 0.48
68 0.5
69 0.5
70 0.44
71 0.38
72 0.31
73 0.26
74 0.22
75 0.19
76 0.15
77 0.14
78 0.14
79 0.15
80 0.14
81 0.13
82 0.12
83 0.14
84 0.14
85 0.13
86 0.12
87 0.09
88 0.09
89 0.07
90 0.08
91 0.06
92 0.06
93 0.07
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.07
100 0.07
101 0.06
102 0.06
103 0.05
104 0.05
105 0.06
106 0.07
107 0.09
108 0.09
109 0.1
110 0.1
111 0.14
112 0.16
113 0.22
114 0.25
115 0.26
116 0.28
117 0.28
118 0.29
119 0.31
120 0.3
121 0.26
122 0.24
123 0.23
124 0.22
125 0.24
126 0.27
127 0.22
128 0.26
129 0.29
130 0.35
131 0.35
132 0.35
133 0.34
134 0.3
135 0.3
136 0.28
137 0.23
138 0.18
139 0.18
140 0.18
141 0.17
142 0.17
143 0.18
144 0.14
145 0.13
146 0.1
147 0.09
148 0.1
149 0.1
150 0.1
151 0.09
152 0.1
153 0.14
154 0.15
155 0.15
156 0.13
157 0.12
158 0.13
159 0.17
160 0.18
161 0.14
162 0.14
163 0.14
164 0.14
165 0.15
166 0.16
167 0.14
168 0.14
169 0.2
170 0.21
171 0.24
172 0.24
173 0.24
174 0.23
175 0.22
176 0.25
177 0.24
178 0.27
179 0.25
180 0.26
181 0.26
182 0.26
183 0.24
184 0.21
185 0.14
186 0.12
187 0.11
188 0.1
189 0.11
190 0.13
191 0.13
192 0.14
193 0.16
194 0.17
195 0.17
196 0.2
197 0.26
198 0.32
199 0.32
200 0.33
201 0.31
202 0.29
203 0.32
204 0.3
205 0.31
206 0.23
207 0.24
208 0.23
209 0.23
210 0.22
211 0.19
212 0.18
213 0.09
214 0.08
215 0.06
216 0.07
217 0.07
218 0.08
219 0.08
220 0.09
221 0.07
222 0.09
223 0.1
224 0.09
225 0.09
226 0.08
227 0.08
228 0.07
229 0.08
230 0.08
231 0.1
232 0.13
233 0.15
234 0.17
235 0.25
236 0.3
237 0.35
238 0.39
239 0.41
240 0.47
241 0.52
242 0.56
243 0.52
244 0.53
245 0.5
246 0.47
247 0.51
248 0.46
249 0.48
250 0.46
251 0.47
252 0.42
253 0.41
254 0.39
255 0.36
256 0.36
257 0.29
258 0.27
259 0.26
260 0.25
261 0.26
262 0.28
263 0.25
264 0.21
265 0.22
266 0.22
267 0.19
268 0.18
269 0.16
270 0.14
271 0.13
272 0.13
273 0.1
274 0.15
275 0.14
276 0.15
277 0.16
278 0.18
279 0.16
280 0.16
281 0.18
282 0.14
283 0.21
284 0.25
285 0.3
286 0.28
287 0.28
288 0.28
289 0.27
290 0.3
291 0.27
292 0.24
293 0.24
294 0.26
295 0.25
296 0.25
297 0.23
298 0.2
299 0.15
300 0.13
301 0.1
302 0.08
303 0.1
304 0.13
305 0.12
306 0.11
307 0.12
308 0.14
309 0.16
310 0.18
311 0.19
312 0.22
313 0.28
314 0.31
315 0.32
316 0.35
317 0.35
318 0.37
319 0.35
320 0.32
321 0.27
322 0.25
323 0.28
324 0.24
325 0.24
326 0.24
327 0.25
328 0.31
329 0.37
330 0.36
331 0.33
332 0.38
333 0.38
334 0.36
335 0.36
336 0.3
337 0.27
338 0.26
339 0.24
340 0.19
341 0.17
342 0.18
343 0.2
344 0.21
345 0.21
346 0.23
347 0.3
348 0.32
349 0.33
350 0.34
351 0.31
352 0.27
353 0.23
354 0.23
355 0.16
356 0.16
357 0.14
358 0.12
359 0.15
360 0.15
361 0.15
362 0.14
363 0.16
364 0.15
365 0.18
366 0.17
367 0.15
368 0.14
369 0.14
370 0.18
371 0.2
372 0.23
373 0.22
374 0.21
375 0.22
376 0.25
377 0.26
378 0.24
379 0.22
380 0.2
381 0.2
382 0.27
383 0.32
384 0.38
385 0.39
386 0.4
387 0.44
388 0.48
389 0.53
390 0.53
391 0.54
392 0.5
393 0.51
394 0.53
395 0.5