FuNGI

P22149

Protein Details

Accession

P22149

Localization Confidence

High

Confidence Score

18.1

NoLS Segment(s)

Position	Sequence	Protein Nature
137-170	FKVVFKCKAAKRGRNARRKRKDKPKGQDHEDEKS	Basic
193-219	TSPDQTSSIKPKKKRCVSRFNNCPFRV	Hydrophilic

NLS Segment(s)

Position	Sequence
144-162	KAAKRGRNARRKRKDKPKG

Subcellular Location(s)

nucl 22, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR014842 AFT
Gene Ontology	GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0000987 F:cis-regulatory region sequence-specific DNA binding GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0043515 F:kinetochore binding GO:0046872 F:metal ion binding GO:0032048 P:cardiolipin metabolic process GO:0007059 P:chromosome segregation GO:0034087 P:establishment of mitotic sister chromatid cohesion GO:0045132 P:meiotic chromosome segregation GO:0000122 P:negative regulation of transcription by RNA polymerase II GO:0034758 P:positive regulation of iron ion transport GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0036086 P:positive regulation of transcription from RNA polymerase II promoter in response to iron ion starvation
KEGG	sce:YGL071W -
Pfam	View protein in Pfam PF08731 AFT

Amino Acid Sequences

MEGFNPADIEHASPINSSDSHSSSFVYALPKSASEYVVNHNEGRASASGNPAAVPSPIMTLNLKSTHSLNIDQHVHTSTSPTETIGHIHHVEKLNQNNLIHLDPVPNFEDKSDIKPWLQKIFYPQGIELVIERSDAFKVVFKCKAAKRGRNARRKRKDKPKGQDHEDEKSKINDDELEYASPSNATVTNGPQTSPDQTSSIKPKKKRCVSRFNNCPFRVRATYSLKRKRWSIVVMDNNHSHQLKFNPDSEEYKKFKEKLRKDNDVDAIKKFDELEYRTLANLPIPTATIPCDCGLTNEIQSFNVVLPTNSNVTSSASSSTVSSISLDSSNASKRPCLPSVNNTGSINTNNVRKPKSQCKNKDTLLKRTTMQNFLTTKSRLRKTGTPTSSQHSSTAFSGYIDDPFNLNEILPLPASDFKLNTVTNLNEIDFTNIFTKSPHPHSGSTHPRQVFDQLDDCSSILFSPLTTNTNNEFEGESDDFVHSPYLNSEADFSQILSSAPPVHHDPNETHQENQDIIDRFANSSQEHNEYILQYLTHSDAANHNNIGVPNNNSHSLNTQHNVSDLGNSLLRQEALVGSSSTKIFDELKFVQNGPHGSQHPIDFQHVDHRHLSSNEPQVRSHQYGPQQQPPQQLQYHQNQPHDGHNHEQHQTVQKDMQTHESLEIMGNTLLEEFKDIKMVNGELKYVKPED

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.17
3	0.16
4	0.17
5	0.19
6	0.21
7	0.23
8	0.24
9	0.23
10	0.21
11	0.21
12	0.22
13	0.22
14	0.19
15	0.19
16	0.2
17	0.19
18	0.23
19	0.24
20	0.23
21	0.22
22	0.24
23	0.29
24	0.34
25	0.36
26	0.33
27	0.32
28	0.3
29	0.28
30	0.28
31	0.21
32	0.17
33	0.17
34	0.21
35	0.21
36	0.2
37	0.2
38	0.18
39	0.18
40	0.15
41	0.14
42	0.1
43	0.11
44	0.11
45	0.13
46	0.14
47	0.15
48	0.2
49	0.22
50	0.22
51	0.22
52	0.23
53	0.26
54	0.28
55	0.31
56	0.29
57	0.34
58	0.37
59	0.35
60	0.36
61	0.33
62	0.31
63	0.26
64	0.27
65	0.2
66	0.2
67	0.2
68	0.19
69	0.18
70	0.17
71	0.2
72	0.18
73	0.22
74	0.21
75	0.21
76	0.26
77	0.29
78	0.32
79	0.37
80	0.41
81	0.41
82	0.44
83	0.43
84	0.39
85	0.38
86	0.35
87	0.29
88	0.23
89	0.23
90	0.19
91	0.22
92	0.22
93	0.2
94	0.19
95	0.18
96	0.23
97	0.2
98	0.25
99	0.26
100	0.27
101	0.29
102	0.35
103	0.39
104	0.41
105	0.41
106	0.37
107	0.41
108	0.46
109	0.47
110	0.43
111	0.39
112	0.33
113	0.33
114	0.31
115	0.23
116	0.17
117	0.14
118	0.11
119	0.12
120	0.1
121	0.1
122	0.11
123	0.11
124	0.13
125	0.17
126	0.22
127	0.26
128	0.27
129	0.35
130	0.39
131	0.48
132	0.54
133	0.58
134	0.63
135	0.7
136	0.78
137	0.81
138	0.88
139	0.89
140	0.9
141	0.92
142	0.92
143	0.93
144	0.93
145	0.93
146	0.93
147	0.93
148	0.91
149	0.88
150	0.87
151	0.81
152	0.8
153	0.75
154	0.67
155	0.58
156	0.51
157	0.46
158	0.37
159	0.32
160	0.26
161	0.22
162	0.23
163	0.22
164	0.2
165	0.19
166	0.18
167	0.17
168	0.14
169	0.12
170	0.09
171	0.08
172	0.08
173	0.09
174	0.12
175	0.17
176	0.17
177	0.17
178	0.18
179	0.19
180	0.21
181	0.22
182	0.21
183	0.19
184	0.2
185	0.26
186	0.34
187	0.42
188	0.45
189	0.5
190	0.59
191	0.67
192	0.76
193	0.82
194	0.8
195	0.82
196	0.85
197	0.88
198	0.89
199	0.88
200	0.88
201	0.79
202	0.74
203	0.65
204	0.62
205	0.55
206	0.48
207	0.47
208	0.46
209	0.53
210	0.59
211	0.67
212	0.65
213	0.65
214	0.64
215	0.6
216	0.56
217	0.52
218	0.48
219	0.47
220	0.5
221	0.5
222	0.51
223	0.49
224	0.44
225	0.44
226	0.37
227	0.28
228	0.23
229	0.23
230	0.26
231	0.27
232	0.29
233	0.29
234	0.31
235	0.36
236	0.38
237	0.43
238	0.38
239	0.4
240	0.43
241	0.43
242	0.48
243	0.52
244	0.57
245	0.6
246	0.66
247	0.7
248	0.68
249	0.72
250	0.72
251	0.68
252	0.61
253	0.51
254	0.45
255	0.35
256	0.32
257	0.25
258	0.19
259	0.17
260	0.18
261	0.19
262	0.18
263	0.19
264	0.18
265	0.19
266	0.18
267	0.14
268	0.12
269	0.1
270	0.08
271	0.08
272	0.08
273	0.08
274	0.09
275	0.08
276	0.09
277	0.09
278	0.1
279	0.09
280	0.1
281	0.11
282	0.11
283	0.12
284	0.12
285	0.12
286	0.11
287	0.11
288	0.11
289	0.09
290	0.1
291	0.09
292	0.07
293	0.08
294	0.09
295	0.1
296	0.1
297	0.1
298	0.09
299	0.1
300	0.11
301	0.11
302	0.1
303	0.09
304	0.1
305	0.09
306	0.1
307	0.08
308	0.08
309	0.07
310	0.06
311	0.07
312	0.07
313	0.07
314	0.07
315	0.08
316	0.1
317	0.12
318	0.12
319	0.12
320	0.16
321	0.2
322	0.22
323	0.25
324	0.26
325	0.29
326	0.37
327	0.39
328	0.38
329	0.34
330	0.32
331	0.29
332	0.26
333	0.23
334	0.17
335	0.18
336	0.19
337	0.23
338	0.25
339	0.28
340	0.34
341	0.43
342	0.51
343	0.56
344	0.63
345	0.66
346	0.71
347	0.72
348	0.75
349	0.69
350	0.69
351	0.62
352	0.54
353	0.48
354	0.48
355	0.47
356	0.42
357	0.38
358	0.34
359	0.32
360	0.32
361	0.35
362	0.29
363	0.31
364	0.34
365	0.37
366	0.34
367	0.37
368	0.41
369	0.44
370	0.53
371	0.51
372	0.49
373	0.48
374	0.49
375	0.48
376	0.43
377	0.36
378	0.27
379	0.25
380	0.2
381	0.19
382	0.15
383	0.11
384	0.12
385	0.11
386	0.12
387	0.11
388	0.11
389	0.09
390	0.09
391	0.1
392	0.08
393	0.08
394	0.06
395	0.07
396	0.07
397	0.07
398	0.07
399	0.07
400	0.09
401	0.11
402	0.11
403	0.1
404	0.11
405	0.15
406	0.15
407	0.15
408	0.15
409	0.14
410	0.15
411	0.16
412	0.15
413	0.12
414	0.12
415	0.14
416	0.11
417	0.13
418	0.12
419	0.12
420	0.12
421	0.11
422	0.15
423	0.17
424	0.23
425	0.27
426	0.29
427	0.31
428	0.35
429	0.44
430	0.5
431	0.5
432	0.53
433	0.48
434	0.45
435	0.44
436	0.45
437	0.37
438	0.3
439	0.29
440	0.22
441	0.22
442	0.21
443	0.2
444	0.15
445	0.13
446	0.1
447	0.07
448	0.06
449	0.05
450	0.06
451	0.08
452	0.11
453	0.11
454	0.14
455	0.16
456	0.18
457	0.18
458	0.17
459	0.16
460	0.14
461	0.18
462	0.17
463	0.14
464	0.13
465	0.13
466	0.12
467	0.12
468	0.13
469	0.08
470	0.08
471	0.08
472	0.1
473	0.1
474	0.1
475	0.11
476	0.11
477	0.12
478	0.12
479	0.12
480	0.09
481	0.09
482	0.09
483	0.07
484	0.08
485	0.09
486	0.09
487	0.11
488	0.15
489	0.18
490	0.19
491	0.22
492	0.23
493	0.28
494	0.37
495	0.36
496	0.33
497	0.31
498	0.32
499	0.3
500	0.29
501	0.29
502	0.21
503	0.21
504	0.22
505	0.21
506	0.2
507	0.21
508	0.23
509	0.17
510	0.18
511	0.21
512	0.21
513	0.21
514	0.22
515	0.22
516	0.19
517	0.2
518	0.17
519	0.14
520	0.11
521	0.12
522	0.12
523	0.12
524	0.11
525	0.11
526	0.16
527	0.2
528	0.22
529	0.21
530	0.19
531	0.2
532	0.2
533	0.21
534	0.19
535	0.19
536	0.19
537	0.22
538	0.25
539	0.23
540	0.24
541	0.25
542	0.26
543	0.29
544	0.27
545	0.27
546	0.25
547	0.24
548	0.25
549	0.22
550	0.2
551	0.15
552	0.16
553	0.15
554	0.14
555	0.14
556	0.14
557	0.13
558	0.11
559	0.11
560	0.09
561	0.09
562	0.1
563	0.1
564	0.1
565	0.12
566	0.12
567	0.12
568	0.12
569	0.13
570	0.14
571	0.14
572	0.2
573	0.22
574	0.27
575	0.28
576	0.29
577	0.3
578	0.31
579	0.34
580	0.29
581	0.32
582	0.29
583	0.3
584	0.33
585	0.32
586	0.32
587	0.32
588	0.32
589	0.27
590	0.26
591	0.33
592	0.33
593	0.35
594	0.33
595	0.33
596	0.34
597	0.35
598	0.38
599	0.35
600	0.43
601	0.46
602	0.45
603	0.44
604	0.45
605	0.51
606	0.52
607	0.48
608	0.44
609	0.46
610	0.54
611	0.6
612	0.63
613	0.63
614	0.63
615	0.68
616	0.67
617	0.65
618	0.59
619	0.58
620	0.56
621	0.58
622	0.64
623	0.61
624	0.6
625	0.59
626	0.57
627	0.6
628	0.58
629	0.53
630	0.51
631	0.52
632	0.54
633	0.51
634	0.51
635	0.48
636	0.52
637	0.49
638	0.45
639	0.42
640	0.38
641	0.41
642	0.41
643	0.42
644	0.36
645	0.36
646	0.33
647	0.29
648	0.27
649	0.23
650	0.22
651	0.16
652	0.13
653	0.11
654	0.1
655	0.1
656	0.1
657	0.08
658	0.11
659	0.11
660	0.11
661	0.16
662	0.16
663	0.18
664	0.21
665	0.23
666	0.27
667	0.26
668	0.29
669	0.27
670	0.28

P22149

3D AlphaFold-predicted Structure Viewer