Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q12395

Protein Details
Accession Q12395    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-45SLTKCDPKVSRKYLQRNHWNINYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014764  DCN-prot  
IPR042460  DCN1-like_PONY  
IPR005176  PONY_dom  
IPR009060  UBA-like_sf  
Gene Ontology GO:0000151  C:ubiquitin ligase complex  
GO:0097602  F:cullin family protein binding  
GO:0030674  F:protein-macromolecule adaptor activity  
GO:0031624  F:ubiquitin conjugating enzyme binding  
GO:0032182  F:ubiquitin-like protein binding  
GO:0051443  P:positive regulation of ubiquitin-protein transferase activity  
GO:0045116  P:protein neddylation  
KEGG sce:YLR128W  -  
Pfam View protein in Pfam  
PF03556  Cullin_binding  
PF14555  UBA_4  
PROSITE View protein in PROSITE  
PS51229  DCUN1  
CDD cd14352  UBA_DCN1  
Amino Acid Sequences MSNNKIKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.5
4 0.44
5 0.34
6 0.25
7 0.2
8 0.19
9 0.17
10 0.15
11 0.19
12 0.21
13 0.21
14 0.29
15 0.36
16 0.41
17 0.51
18 0.58
19 0.64
20 0.68
21 0.77
22 0.79
23 0.82
24 0.84
25 0.83
26 0.84
27 0.8
28 0.74
29 0.64
30 0.61
31 0.52
32 0.44
33 0.36
34 0.29
35 0.25
36 0.22
37 0.24
38 0.18
39 0.16
40 0.14
41 0.13
42 0.12
43 0.14
44 0.13
45 0.1
46 0.12
47 0.12
48 0.12
49 0.13
50 0.13
51 0.1
52 0.1
53 0.11
54 0.09
55 0.11
56 0.15
57 0.17
58 0.17
59 0.16
60 0.23
61 0.25
62 0.27
63 0.26
64 0.25
65 0.24
66 0.27
67 0.27
68 0.21
69 0.24
70 0.22
71 0.22
72 0.18
73 0.16
74 0.13
75 0.12
76 0.13
77 0.09
78 0.09
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.07
85 0.06
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.06
93 0.06
94 0.06
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.07
102 0.08
103 0.1
104 0.11
105 0.12
106 0.12
107 0.16
108 0.2
109 0.19
110 0.21
111 0.28
112 0.31
113 0.31
114 0.31
115 0.28
116 0.24
117 0.25
118 0.25
119 0.17
120 0.14
121 0.14
122 0.14
123 0.13
124 0.12
125 0.1
126 0.07
127 0.08
128 0.08
129 0.08
130 0.08
131 0.08
132 0.09
133 0.1
134 0.09
135 0.09
136 0.09
137 0.1
138 0.09
139 0.14
140 0.14
141 0.16
142 0.17
143 0.19
144 0.19
145 0.19
146 0.2
147 0.16
148 0.17
149 0.15
150 0.14
151 0.12
152 0.12
153 0.12
154 0.13
155 0.11
156 0.1
157 0.1
158 0.1
159 0.11
160 0.1
161 0.13
162 0.15
163 0.16
164 0.17
165 0.18
166 0.18
167 0.17
168 0.17
169 0.21
170 0.2
171 0.21
172 0.19
173 0.19
174 0.2
175 0.2
176 0.18
177 0.12
178 0.1
179 0.09
180 0.09
181 0.08
182 0.11
183 0.2
184 0.23
185 0.28
186 0.29
187 0.3
188 0.31
189 0.31
190 0.29
191 0.2
192 0.2
193 0.16
194 0.14
195 0.15
196 0.13
197 0.16
198 0.16
199 0.16
200 0.13
201 0.13
202 0.18
203 0.19
204 0.22
205 0.21
206 0.26
207 0.27
208 0.29
209 0.33
210 0.3
211 0.31
212 0.31
213 0.32
214 0.29
215 0.29
216 0.27
217 0.23
218 0.3
219 0.3
220 0.33
221 0.31
222 0.32
223 0.33
224 0.34
225 0.4
226 0.38
227 0.4
228 0.38
229 0.41
230 0.42
231 0.44
232 0.45
233 0.41
234 0.35
235 0.3
236 0.26
237 0.23
238 0.19
239 0.16
240 0.12
241 0.1
242 0.09
243 0.08
244 0.09
245 0.09
246 0.09
247 0.13
248 0.13
249 0.15