Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P12962

Protein Details
Accession P12962    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-76HFGRRRSSHHHGRPKIKHNKPKVTTBasic
NLS Segment(s)
PositionSequence
55-72RRRSSHHHGRPKIKHNKP
Subcellular Location(s) cyto 17, cyto_nucl 13.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR031456  Caf20  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005845  C:mRNA cap binding complex  
GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0003743  F:translation initiation factor activity  
GO:0017148  P:negative regulation of translation  
GO:0010606  P:positive regulation of cytoplasmic mRNA processing body assembly  
GO:0045727  P:positive regulation of translation  
KEGG sce:YOR276W  -  
Pfam View protein in Pfam  
PF17052  CAF20  
Amino Acid Sequences MIKYTIDELFQLKPSLTLEVNFDAVEFRAIIEKVKQLQHLKEEEFNSHHVGHFGRRRSSHHHGRPKIKHNKPKVTTDSDGWCTFEAKKKGSGEDDEEETETTPTSTVPVATIAQETLKVKPNNKNISSNRPADTRDIVADKPILGFNAFAALESEDEDDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.18
4 0.16
5 0.17
6 0.18
7 0.19
8 0.17
9 0.16
10 0.13
11 0.13
12 0.13
13 0.09
14 0.07
15 0.1
16 0.1
17 0.12
18 0.13
19 0.17
20 0.21
21 0.24
22 0.31
23 0.32
24 0.36
25 0.41
26 0.43
27 0.41
28 0.42
29 0.41
30 0.37
31 0.35
32 0.33
33 0.3
34 0.26
35 0.24
36 0.2
37 0.19
38 0.23
39 0.26
40 0.29
41 0.31
42 0.33
43 0.36
44 0.43
45 0.51
46 0.55
47 0.59
48 0.65
49 0.68
50 0.76
51 0.8
52 0.82
53 0.84
54 0.82
55 0.82
56 0.81
57 0.83
58 0.77
59 0.77
60 0.72
61 0.68
62 0.61
63 0.54
64 0.48
65 0.41
66 0.38
67 0.3
68 0.25
69 0.19
70 0.19
71 0.23
72 0.22
73 0.2
74 0.24
75 0.24
76 0.26
77 0.27
78 0.28
79 0.26
80 0.25
81 0.26
82 0.22
83 0.21
84 0.19
85 0.17
86 0.15
87 0.11
88 0.08
89 0.06
90 0.05
91 0.06
92 0.06
93 0.05
94 0.06
95 0.07
96 0.07
97 0.08
98 0.08
99 0.08
100 0.08
101 0.11
102 0.11
103 0.13
104 0.21
105 0.24
106 0.29
107 0.37
108 0.47
109 0.54
110 0.57
111 0.64
112 0.61
113 0.68
114 0.68
115 0.64
116 0.58
117 0.51
118 0.49
119 0.44
120 0.41
121 0.33
122 0.31
123 0.29
124 0.27
125 0.26
126 0.25
127 0.21
128 0.19
129 0.18
130 0.15
131 0.12
132 0.12
133 0.1
134 0.13
135 0.12
136 0.11
137 0.12
138 0.11
139 0.11
140 0.12
141 0.14