Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O14464

Protein Details
Accession O14464   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-93RRKGRVYIYCKSNKKHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
GO:0042254  P:ribosome biogenesis  
KEGG sce:YPL183W-A  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MFLQTLRLTMPRMFLHMKPSPITITRACTVPSLLSVAAPQPALVAANRPLVFNRGFKVRTSVKKFCSDCYLVRRKGRVYIYCKSNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.35
4 0.36
5 0.32
6 0.34
7 0.32
8 0.3
9 0.33
10 0.27
11 0.27
12 0.26
13 0.26
14 0.25
15 0.22
16 0.2
17 0.16
18 0.15
19 0.12
20 0.1
21 0.09
22 0.08
23 0.08
24 0.08
25 0.08
26 0.07
27 0.05
28 0.05
29 0.06
30 0.05
31 0.06
32 0.07
33 0.11
34 0.12
35 0.12
36 0.12
37 0.15
38 0.16
39 0.16
40 0.16
41 0.17
42 0.18
43 0.18
44 0.24
45 0.29
46 0.37
47 0.44
48 0.49
49 0.48
50 0.56
51 0.57
52 0.54
53 0.53
54 0.48
55 0.44
56 0.48
57 0.53
58 0.51
59 0.56
60 0.58
61 0.54
62 0.58
63 0.6
64 0.59
65 0.57
66 0.58
67 0.62
68 0.67
69 0.72
70 0.71
71 0.74
72 0.76
73 0.8