Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q06011

Protein Details
Accession Q06011   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-38LFSHSTDKSNKHKKRQVQCNMRKNTLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 5
Family & Domain DBs
Gene Ontology GO:0031966  C:mitochondrial membrane  
GO:0005739  C:mitochondrion  
GO:0071555  P:cell wall organization  
KEGG sce:YLR390W  -  
Amino Acid Sequences MDWLKNTTIVVLFSHSTDKSNKHKKRQVQCNMRKNTLDMVTIGIACLVGVYTGTRFFEPIVIDRLRKDGNLRTDIPIPEYDEDGNLLKVTPSLSSTPAAPPTPPTPPTPPQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.18
4 0.21
5 0.27
6 0.35
7 0.45
8 0.53
9 0.6
10 0.68
11 0.75
12 0.82
13 0.86
14 0.87
15 0.87
16 0.89
17 0.88
18 0.87
19 0.82
20 0.72
21 0.63
22 0.57
23 0.47
24 0.38
25 0.28
26 0.22
27 0.18
28 0.16
29 0.14
30 0.09
31 0.06
32 0.05
33 0.05
34 0.03
35 0.02
36 0.02
37 0.03
38 0.03
39 0.04
40 0.05
41 0.05
42 0.06
43 0.06
44 0.08
45 0.08
46 0.09
47 0.13
48 0.14
49 0.15
50 0.15
51 0.18
52 0.17
53 0.17
54 0.19
55 0.2
56 0.25
57 0.29
58 0.3
59 0.3
60 0.34
61 0.33
62 0.32
63 0.28
64 0.24
65 0.21
66 0.2
67 0.18
68 0.14
69 0.15
70 0.14
71 0.13
72 0.1
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.09
79 0.1
80 0.12
81 0.13
82 0.15
83 0.18
84 0.22
85 0.22
86 0.2
87 0.23
88 0.26
89 0.31
90 0.32
91 0.34
92 0.37