Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53688

Protein Details
Accession P53688    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-58NENLKPRRLLPQLKKSVRNRKPRLSYRPELNSVHydrophilic
NLS Segment(s)
PositionSequence
38-47LKKSVRNRKP
Subcellular Location(s) nucl 13, mito_nucl 11.666, cyto_nucl 9.666, mito 9, cyto_mito 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR029035  DHS-like_NAD/FAD-binding_dom  
IPR003000  Sirtuin  
IPR026591  Sirtuin_cat_small_dom_sf  
IPR026590  Ssirtuin_cat_dom  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005737  C:cytoplasm  
GO:0031934  C:mating-type region heterochromatin  
GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0070403  F:NAD+ binding  
GO:0017136  F:NAD-dependent histone deacetylase activity  
GO:0016740  F:transferase activity  
GO:0009299  P:mRNA transcription  
GO:0098781  P:ncRNA transcription  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0031508  P:pericentric heterochromatin formation  
GO:0006282  P:regulation of DNA repair  
GO:1990414  P:replication-born double-strand break repair via sister chromatid exchange  
GO:0046459  P:short-chain fatty acid metabolic process  
GO:0031509  P:subtelomeric heterochromatin formation  
KEGG sce:YDR191W  -  
Pfam View protein in Pfam  
PF02146  SIR2  
PROSITE View protein in PROSITE  
PS50305  SIRTUIN  
Amino Acid Sequences MKQKFVLPITPPSTAEKKPQTENRCNENLKPRRLLPQLKKSVRNRKPRLSYRPELNSVFDLDAYVDSTHLSKSQRHHMDRDAGFISYALNYSKRMVVVSGAGISVAAGIPDFRSSEGIFSTVNGGSGKDLFDYNRVYGDESMSLKFNQLMVSLFRLSKNCQPTKFHEMLNEFARDGRLLRLYTQNIDGLDTQLPHLSTNVPLAKPIPSTVQLHGSIKHMECNKCLNIKPFDPELFKCDDKFDSRTEIIPSCPQCEEYETVRKMAGLRSTGVGKLRPRVILYNEVHPEGDFIGEIANNDLKKRIDCLIIVGTSLKIPGVKNICRQFAAKVHANRGIVLYLNTSMPPKNVLDSLKFVDLVVLGDCQHVTSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.49
4 0.5
5 0.57
6 0.65
7 0.68
8 0.73
9 0.77
10 0.76
11 0.77
12 0.75
13 0.73
14 0.74
15 0.74
16 0.71
17 0.7
18 0.65
19 0.65
20 0.7
21 0.73
22 0.73
23 0.74
24 0.77
25 0.79
26 0.85
27 0.86
28 0.88
29 0.87
30 0.88
31 0.86
32 0.86
33 0.88
34 0.89
35 0.89
36 0.88
37 0.86
38 0.85
39 0.83
40 0.79
41 0.7
42 0.63
43 0.54
44 0.47
45 0.39
46 0.29
47 0.21
48 0.16
49 0.14
50 0.12
51 0.1
52 0.08
53 0.08
54 0.09
55 0.09
56 0.12
57 0.15
58 0.18
59 0.23
60 0.33
61 0.42
62 0.46
63 0.5
64 0.52
65 0.59
66 0.55
67 0.55
68 0.46
69 0.36
70 0.32
71 0.27
72 0.22
73 0.12
74 0.13
75 0.09
76 0.09
77 0.1
78 0.12
79 0.14
80 0.13
81 0.13
82 0.12
83 0.12
84 0.12
85 0.12
86 0.11
87 0.09
88 0.08
89 0.07
90 0.07
91 0.06
92 0.04
93 0.03
94 0.03
95 0.03
96 0.04
97 0.05
98 0.05
99 0.05
100 0.07
101 0.08
102 0.09
103 0.09
104 0.1
105 0.09
106 0.09
107 0.12
108 0.1
109 0.11
110 0.1
111 0.1
112 0.09
113 0.1
114 0.1
115 0.08
116 0.08
117 0.08
118 0.11
119 0.13
120 0.12
121 0.14
122 0.14
123 0.15
124 0.14
125 0.15
126 0.15
127 0.14
128 0.15
129 0.14
130 0.14
131 0.13
132 0.13
133 0.12
134 0.1
135 0.09
136 0.09
137 0.09
138 0.12
139 0.13
140 0.13
141 0.14
142 0.15
143 0.17
144 0.22
145 0.3
146 0.32
147 0.34
148 0.38
149 0.43
150 0.5
151 0.49
152 0.45
153 0.41
154 0.38
155 0.38
156 0.36
157 0.3
158 0.22
159 0.2
160 0.19
161 0.14
162 0.13
163 0.11
164 0.11
165 0.1
166 0.12
167 0.17
168 0.17
169 0.18
170 0.19
171 0.18
172 0.16
173 0.16
174 0.15
175 0.11
176 0.11
177 0.1
178 0.09
179 0.09
180 0.09
181 0.08
182 0.08
183 0.07
184 0.07
185 0.12
186 0.14
187 0.13
188 0.13
189 0.14
190 0.14
191 0.14
192 0.15
193 0.12
194 0.13
195 0.15
196 0.16
197 0.19
198 0.2
199 0.21
200 0.21
201 0.21
202 0.21
203 0.19
204 0.23
205 0.24
206 0.24
207 0.25
208 0.29
209 0.3
210 0.31
211 0.34
212 0.35
213 0.34
214 0.34
215 0.36
216 0.34
217 0.35
218 0.33
219 0.32
220 0.29
221 0.3
222 0.29
223 0.25
224 0.24
225 0.24
226 0.24
227 0.26
228 0.24
229 0.25
230 0.25
231 0.27
232 0.27
233 0.26
234 0.24
235 0.28
236 0.27
237 0.24
238 0.24
239 0.23
240 0.21
241 0.23
242 0.24
243 0.23
244 0.31
245 0.29
246 0.3
247 0.28
248 0.28
249 0.27
250 0.27
251 0.25
252 0.18
253 0.18
254 0.19
255 0.2
256 0.21
257 0.22
258 0.24
259 0.23
260 0.27
261 0.29
262 0.29
263 0.3
264 0.32
265 0.34
266 0.38
267 0.38
268 0.4
269 0.39
270 0.38
271 0.36
272 0.32
273 0.28
274 0.19
275 0.17
276 0.09
277 0.06
278 0.06
279 0.06
280 0.07
281 0.08
282 0.11
283 0.11
284 0.12
285 0.16
286 0.17
287 0.17
288 0.2
289 0.21
290 0.2
291 0.2
292 0.24
293 0.24
294 0.23
295 0.23
296 0.2
297 0.18
298 0.15
299 0.15
300 0.12
301 0.1
302 0.1
303 0.17
304 0.24
305 0.29
306 0.37
307 0.44
308 0.47
309 0.46
310 0.47
311 0.45
312 0.44
313 0.47
314 0.46
315 0.45
316 0.48
317 0.51
318 0.5
319 0.46
320 0.41
321 0.34
322 0.27
323 0.22
324 0.19
325 0.14
326 0.15
327 0.15
328 0.16
329 0.16
330 0.16
331 0.19
332 0.18
333 0.19
334 0.23
335 0.26
336 0.28
337 0.31
338 0.34
339 0.33
340 0.32
341 0.29
342 0.25
343 0.22
344 0.19
345 0.15
346 0.12
347 0.1
348 0.11
349 0.11
350 0.1