Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4MJD3

Protein Details
Accession A0A0G4MJD3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
93-115ERLAEYKKKKEAKPKTTAKSVVTHydrophilic
NLS Segment(s)
PositionSequence
99-107KKKKEAKPK
Subcellular Location(s) nucl 12, cyto_nucl 11.833, cyto 10.5, mito_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR018940  EF-1_beta_acid_region_euk  
IPR001326  Transl_elong_EF1B_B/D_CS  
Gene Ontology GO:0005853  C:eukaryotic translation elongation factor 1 complex  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF10587  EF-1_beta_acid  
PROSITE View protein in PROSITE  
PS00824  EF1BD_1  
Amino Acid Sequences ADVAVFKALSSGPDAAKYPYAARWYKHIATYESEFASLAGDASKPYSVYGPEAGELTLNPAKAPAAEEDEDDVDLFGSDDEEEDAEAARIREERLAEYKKKKEAKPKTTAKSVVTLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.19
5 0.18
6 0.2
7 0.26
8 0.27
9 0.27
10 0.31
11 0.37
12 0.38
13 0.4
14 0.39
15 0.35
16 0.35
17 0.38
18 0.35
19 0.28
20 0.25
21 0.21
22 0.18
23 0.16
24 0.12
25 0.08
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.09
41 0.08
42 0.07
43 0.1
44 0.1
45 0.09
46 0.09
47 0.08
48 0.09
49 0.09
50 0.1
51 0.07
52 0.1
53 0.1
54 0.11
55 0.12
56 0.12
57 0.12
58 0.11
59 0.1
60 0.06
61 0.05
62 0.05
63 0.04
64 0.04
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.08
77 0.08
78 0.11
79 0.12
80 0.16
81 0.23
82 0.3
83 0.38
84 0.46
85 0.53
86 0.59
87 0.67
88 0.7
89 0.73
90 0.77
91 0.78
92 0.79
93 0.83
94 0.82
95 0.82
96 0.81
97 0.73