Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q03935

Protein Details
Accession Q03935    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
235-254QKAFRQRKEKYIKNLEQKSKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0001010  F:RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
KEGG sce:YDR259C  -  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MQNPPLIRPDMYNQGSSSMATYNASEKNLNEHPSPQIAQPSTSQKLPYRINPTTTNGDTDISVNSNPIQPPLPNLMHLSGPSDYRSMHQSPIHPSYIIPPHSNERKQSASYNRPQNAHVSIQPSVVFPPKSYSISYAPYQINPPLPNGLPNQSISLNKEYIAEEQLSTLPSRNTSVTTAPPSFQNSADTAKNSADNNDNNDNVTKPVPDKDTQLISSSGKTLRNTRRAAQNRTAQKAFRQRKEKYIKNLEQKSKIFDDLLAENNNFKSLNDSLRNDNNILIAQHEAIRNAITMLRSEYDVLCNENNMLKNENSIIKNEHNMSRNENENLKLENKRFHAEYIRMIEDIENTKRKEQEQRDEIEQLKKKIRSLEEIVGRHSDSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.29
4 0.26
5 0.17
6 0.15
7 0.13
8 0.14
9 0.17
10 0.2
11 0.22
12 0.22
13 0.21
14 0.27
15 0.32
16 0.36
17 0.32
18 0.32
19 0.33
20 0.37
21 0.38
22 0.34
23 0.36
24 0.33
25 0.33
26 0.36
27 0.4
28 0.38
29 0.39
30 0.41
31 0.38
32 0.45
33 0.49
34 0.52
35 0.53
36 0.54
37 0.56
38 0.56
39 0.56
40 0.55
41 0.51
42 0.46
43 0.38
44 0.34
45 0.3
46 0.26
47 0.22
48 0.17
49 0.16
50 0.14
51 0.13
52 0.17
53 0.16
54 0.17
55 0.18
56 0.16
57 0.2
58 0.26
59 0.26
60 0.23
61 0.25
62 0.25
63 0.24
64 0.24
65 0.23
66 0.17
67 0.17
68 0.16
69 0.15
70 0.14
71 0.15
72 0.21
73 0.2
74 0.23
75 0.26
76 0.29
77 0.35
78 0.4
79 0.4
80 0.34
81 0.32
82 0.33
83 0.37
84 0.36
85 0.3
86 0.28
87 0.35
88 0.43
89 0.47
90 0.44
91 0.42
92 0.43
93 0.44
94 0.49
95 0.5
96 0.51
97 0.55
98 0.62
99 0.61
100 0.59
101 0.57
102 0.54
103 0.48
104 0.42
105 0.36
106 0.3
107 0.26
108 0.26
109 0.25
110 0.21
111 0.19
112 0.21
113 0.18
114 0.15
115 0.18
116 0.19
117 0.21
118 0.21
119 0.23
120 0.21
121 0.24
122 0.25
123 0.27
124 0.25
125 0.24
126 0.25
127 0.24
128 0.26
129 0.23
130 0.23
131 0.2
132 0.19
133 0.21
134 0.21
135 0.21
136 0.19
137 0.19
138 0.19
139 0.18
140 0.2
141 0.2
142 0.21
143 0.18
144 0.17
145 0.18
146 0.17
147 0.16
148 0.16
149 0.14
150 0.1
151 0.11
152 0.11
153 0.1
154 0.1
155 0.1
156 0.09
157 0.09
158 0.1
159 0.1
160 0.11
161 0.12
162 0.14
163 0.15
164 0.19
165 0.19
166 0.18
167 0.19
168 0.21
169 0.2
170 0.19
171 0.18
172 0.15
173 0.17
174 0.18
175 0.17
176 0.15
177 0.14
178 0.16
179 0.15
180 0.15
181 0.17
182 0.17
183 0.21
184 0.22
185 0.22
186 0.2
187 0.2
188 0.19
189 0.16
190 0.15
191 0.11
192 0.1
193 0.13
194 0.16
195 0.16
196 0.19
197 0.2
198 0.22
199 0.22
200 0.23
201 0.22
202 0.19
203 0.18
204 0.18
205 0.18
206 0.19
207 0.19
208 0.27
209 0.33
210 0.4
211 0.43
212 0.45
213 0.52
214 0.57
215 0.63
216 0.61
217 0.61
218 0.6
219 0.63
220 0.61
221 0.52
222 0.51
223 0.55
224 0.56
225 0.57
226 0.59
227 0.56
228 0.64
229 0.72
230 0.73
231 0.72
232 0.74
233 0.74
234 0.75
235 0.81
236 0.78
237 0.76
238 0.7
239 0.65
240 0.57
241 0.5
242 0.4
243 0.31
244 0.27
245 0.21
246 0.23
247 0.21
248 0.18
249 0.18
250 0.18
251 0.18
252 0.16
253 0.13
254 0.14
255 0.14
256 0.21
257 0.25
258 0.27
259 0.32
260 0.37
261 0.39
262 0.36
263 0.34
264 0.28
265 0.23
266 0.21
267 0.16
268 0.12
269 0.1
270 0.13
271 0.13
272 0.12
273 0.12
274 0.12
275 0.11
276 0.11
277 0.12
278 0.09
279 0.1
280 0.11
281 0.12
282 0.12
283 0.14
284 0.14
285 0.15
286 0.15
287 0.17
288 0.15
289 0.15
290 0.16
291 0.19
292 0.21
293 0.2
294 0.22
295 0.2
296 0.21
297 0.24
298 0.29
299 0.26
300 0.26
301 0.28
302 0.28
303 0.33
304 0.36
305 0.38
306 0.37
307 0.38
308 0.41
309 0.41
310 0.44
311 0.43
312 0.42
313 0.39
314 0.37
315 0.38
316 0.38
317 0.4
318 0.39
319 0.42
320 0.42
321 0.45
322 0.43
323 0.44
324 0.46
325 0.42
326 0.45
327 0.44
328 0.43
329 0.38
330 0.37
331 0.33
332 0.3
333 0.32
334 0.32
335 0.33
336 0.34
337 0.39
338 0.43
339 0.47
340 0.53
341 0.57
342 0.6
343 0.61
344 0.64
345 0.65
346 0.67
347 0.66
348 0.66
349 0.63
350 0.59
351 0.61
352 0.58
353 0.57
354 0.59
355 0.59
356 0.57
357 0.57
358 0.59
359 0.59
360 0.58
361 0.58
362 0.53
363 0.49