Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40525

Protein Details
Accession P40525   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AQRVTFRRRNPYNTRSNKIKHydrophilic
NLS Segment(s)
PositionSequence
112-121AKKSEKKSKK
Subcellular Location(s) mito 20, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042254  P:ribosome biogenesis  
KEGG sce:YIL052C  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIVRAFLIEEQKIVKKVVKEQTEAAKKSEKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.79
4 0.76
5 0.75
6 0.73
7 0.7
8 0.67
9 0.66
10 0.64
11 0.57
12 0.57
13 0.51
14 0.47
15 0.41
16 0.34
17 0.31
18 0.35
19 0.34
20 0.31
21 0.3
22 0.29
23 0.33
24 0.43
25 0.45
26 0.43
27 0.49
28 0.52
29 0.54
30 0.57
31 0.53
32 0.44
33 0.38
34 0.34
35 0.3
36 0.27
37 0.22
38 0.17
39 0.17
40 0.15
41 0.14
42 0.13
43 0.13
44 0.11
45 0.13
46 0.13
47 0.14
48 0.18
49 0.24
50 0.24
51 0.32
52 0.35
53 0.35
54 0.36
55 0.37
56 0.36
57 0.33
58 0.34
59 0.28
60 0.3
61 0.3
62 0.3
63 0.32
64 0.31
65 0.34
66 0.3
67 0.3
68 0.27
69 0.29
70 0.28
71 0.28
72 0.29
73 0.29
74 0.33
75 0.34
76 0.34
77 0.32
78 0.32
79 0.31
80 0.3
81 0.3
82 0.26
83 0.23
84 0.23
85 0.26
86 0.26
87 0.25
88 0.25
89 0.22
90 0.31
91 0.39
92 0.41
93 0.41
94 0.44
95 0.53
96 0.59
97 0.58
98 0.53
99 0.53
100 0.53
101 0.58