Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q08465

Protein Details
Accession Q08465    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
197-219YCSKDCKEIANQRSKSKRQKRRKHydrophilic
NLS Segment(s)
PositionSequence
123-129KKAKSRE
209-219RSKSKRQKRRK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0033100  C:NuA3 histone acetyltransferase complex  
GO:1990467  C:NuA3a histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0033698  C:Rpd3L complex  
GO:0046872  F:metal ion binding  
GO:0035064  F:methylated histone binding  
GO:0006325  P:chromatin organization  
GO:0006338  P:chromatin remodeling  
GO:0006351  P:DNA-templated transcription  
GO:0016573  P:histone acetylation  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG sce:YOR064C  -  
CDD cd17017  ING_Yng1p  
cd15587  PHD_Yng1p_like  
Amino Acid Sequences MEHLANENSDSDIRYSFLSTLDHLPCELIRSLRLMQTIDLFKNEEDEPGMERACRDLLLVATYINDLVDDQIHFLKQHKKELEIQKSVTKNFNSSLENIKSKLTLEEPGAYKEPKLLLKINLKKAKSRERKESITSPTIGINQGDVTEGNNNQEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKSKRQKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.13
4 0.14
5 0.14
6 0.15
7 0.21
8 0.22
9 0.22
10 0.2
11 0.21
12 0.19
13 0.21
14 0.21
15 0.15
16 0.14
17 0.18
18 0.2
19 0.21
20 0.23
21 0.21
22 0.2
23 0.24
24 0.27
25 0.24
26 0.24
27 0.23
28 0.2
29 0.23
30 0.22
31 0.17
32 0.14
33 0.14
34 0.15
35 0.15
36 0.16
37 0.13
38 0.13
39 0.14
40 0.13
41 0.12
42 0.1
43 0.09
44 0.09
45 0.1
46 0.1
47 0.08
48 0.08
49 0.08
50 0.08
51 0.06
52 0.05
53 0.04
54 0.04
55 0.05
56 0.05
57 0.06
58 0.07
59 0.08
60 0.08
61 0.13
62 0.21
63 0.23
64 0.31
65 0.31
66 0.34
67 0.42
68 0.52
69 0.56
70 0.51
71 0.51
72 0.49
73 0.5
74 0.49
75 0.46
76 0.36
77 0.3
78 0.27
79 0.29
80 0.24
81 0.23
82 0.27
83 0.26
84 0.27
85 0.26
86 0.24
87 0.21
88 0.2
89 0.19
90 0.14
91 0.12
92 0.11
93 0.14
94 0.15
95 0.16
96 0.18
97 0.17
98 0.15
99 0.15
100 0.16
101 0.14
102 0.15
103 0.16
104 0.2
105 0.29
106 0.36
107 0.44
108 0.48
109 0.48
110 0.5
111 0.55
112 0.6
113 0.61
114 0.61
115 0.62
116 0.63
117 0.67
118 0.67
119 0.67
120 0.62
121 0.55
122 0.49
123 0.4
124 0.34
125 0.31
126 0.26
127 0.19
128 0.13
129 0.1
130 0.09
131 0.09
132 0.07
133 0.07
134 0.09
135 0.09
136 0.11
137 0.11
138 0.11
139 0.11
140 0.11
141 0.12
142 0.12
143 0.18
144 0.17
145 0.17
146 0.17
147 0.18
148 0.18
149 0.18
150 0.19
151 0.15
152 0.16
153 0.16
154 0.17
155 0.17
156 0.17
157 0.17
158 0.14
159 0.13
160 0.13
161 0.13
162 0.13
163 0.13
164 0.14
165 0.16
166 0.23
167 0.23
168 0.23
169 0.24
170 0.23
171 0.23
172 0.24
173 0.23
174 0.2
175 0.22
176 0.28
177 0.33
178 0.34
179 0.4
180 0.41
181 0.46
182 0.52
183 0.56
184 0.6
185 0.63
186 0.68
187 0.69
188 0.71
189 0.7
190 0.7
191 0.72
192 0.72
193 0.72
194 0.7
195 0.73
196 0.77
197 0.82
198 0.83
199 0.84