Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q03375

Protein Details
Accession Q03375   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-45ASNNRRRPQGSQQQRQQRQNAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005684  C:U2-type spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG sce:YDR482C  -  
Pfam View protein in Pfam  
PF08312  cwf21  
Amino Acid Sequences MSYNGIGLKSAKGSSTSGHVQRSLASNNRRRPQGSQQQRQQRQNAIKKASHDKASRPLAVQKQIETHMEKREIEVQVSELRDRLEEEETLSEEQIDKKCEALRAKLTNEWQEQQRMSSLYTPRKARLTEEQHRHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.26
4 0.28
5 0.31
6 0.31
7 0.29
8 0.3
9 0.33
10 0.33
11 0.34
12 0.39
13 0.45
14 0.54
15 0.6
16 0.62
17 0.6
18 0.61
19 0.63
20 0.65
21 0.67
22 0.67
23 0.7
24 0.76
25 0.83
26 0.84
27 0.78
28 0.76
29 0.75
30 0.74
31 0.73
32 0.68
33 0.61
34 0.59
35 0.63
36 0.58
37 0.56
38 0.49
39 0.45
40 0.47
41 0.49
42 0.46
43 0.38
44 0.4
45 0.37
46 0.42
47 0.39
48 0.31
49 0.28
50 0.29
51 0.3
52 0.27
53 0.25
54 0.23
55 0.24
56 0.23
57 0.22
58 0.26
59 0.24
60 0.21
61 0.18
62 0.16
63 0.17
64 0.18
65 0.17
66 0.12
67 0.12
68 0.11
69 0.12
70 0.12
71 0.11
72 0.1
73 0.11
74 0.12
75 0.13
76 0.13
77 0.12
78 0.11
79 0.1
80 0.14
81 0.15
82 0.16
83 0.15
84 0.16
85 0.19
86 0.24
87 0.26
88 0.29
89 0.34
90 0.37
91 0.4
92 0.43
93 0.46
94 0.48
95 0.49
96 0.48
97 0.44
98 0.44
99 0.41
100 0.38
101 0.36
102 0.3
103 0.28
104 0.3
105 0.34
106 0.37
107 0.44
108 0.47
109 0.48
110 0.53
111 0.52
112 0.52
113 0.54
114 0.55
115 0.58