FuNGI

P39001

Protein Details

Accession

P39001

Localization Confidence

High

Confidence Score

20.9

NoLS Segment(s)

Position	Sequence	Protein Nature
712-750	SPDFAKSKGKNVKPKAKSKAKQSSKKRPNNTTSKSKANN	Hydrophilic
764-793	GTRSRTGCWICRLRKKKCTEERPHCFNCER	Hydrophilic
807-836	FVSDPKKKQMKLEEIKKKTKEAKRRAMKKK	Basic

NLS Segment(s)

Position	Sequence
717-739	KSKGKNVKPKAKSKAKQSSKKRP
812-836	KKKQMKLEEIKKKTKEAKRRAMKKK

Subcellular Location(s)

nucl 23.5, cyto_nucl 16

Family & Domain DBs

InterPro	View protein in InterPro IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0033698 C:Rpd3L complex GO:0070210 C:Rpd3L-Expanded complex GO:0005667 C:transcription regulator complex GO:0140297 F:DNA-binding transcription factor binding GO:0001227 F:DNA-binding transcription repressor activity, RNA polymerase II-specific GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0043565 F:sequence-specific DNA binding GO:0008270 F:zinc ion binding GO:0006338 P:chromatin remodeling GO:0034389 P:lipid droplet organization GO:0000122 P:negative regulation of transcription by RNA polymerase II GO:0010674 P:negative regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0001081 P:nitrogen catabolite repression of transcription from RNA polymerase II promoter GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0010673 P:positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0007124 P:pseudohyphal growth GO:0042173 P:regulation of sporulation resulting in formation of a cellular spore GO:0009847 P:spore germination
KEGG	sce:YDR207C -
Pfam	View protein in Pfam PF00172 Zn_clus
PROSITE	View protein in PROSITE PS00463 ZN2_CY6_FUNGAL_1 PS50048 ZN2_CY6_FUNGAL_2
CDD	cd00067 GAL4

Amino Acid Sequences

MLDKARSQSKHMDESNAAASLLSMETTANNHHYLHNKTSRATLMNSSQDGKKHAEDEVSDGANSRHPTISSASIESLKTTYDENPLLSIMKSTCAPNNTPVHTPSGSPSLKVQSGGDIKDDPKENDTTTTTNTTLQDRRDSDNAVHAAASPLAPSNTPSDPKSLCNGHVAQATDPQISGAIQPQYTATNEDVFPYSSTSTNSNTATTTIVAGAKKKIHLPPPQAPAVSSPGTTAAGSGAGTGSGIRSRTGSDLPLIITSANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNNNEIGGYLRGGTKRGGSPSNDSQVQHNVHDDQCAVGVAPRNFYFNKDREITDPNVKLDENESKINISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQIPSQPPTSASSFTSTNNNNPQRNNINRGEDPFATSSRPSTGFFYGDLPNRNNRNSPFHTNEQYIPPPPPKYINSKLDGLRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDKPISNVNDMNNTNALGVPASRPHSSSFPSKGVLRPILLRIHNSEQQPIFESNNSTAVFDEDQDQNQDLSPYHLNLNSKKVLDPTFESRTRQVTWNKNGKRIDRRLSAPEQQQQLEVPPLKKSRRSVGNARVASQTNSDYNSLGESSTSSAPSSPSLKASSGLAYTADYPNATSPDFAKSKGKNVKPKAKSKAKQSSKKRPNNTTSKSKANNSQESNNATSSTSQGTRSRTGCWICRLRKKKCTEERPHCFNCERLKLDCHYDAFKPDFVSDPKKKQMKLEEIKKKTKEAKRRAMKKK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.5
2	0.48
3	0.39
4	0.32
5	0.23
6	0.2
7	0.15
8	0.14
9	0.1
10	0.07
11	0.06
12	0.07
13	0.09
14	0.13
15	0.15
16	0.17
17	0.18
18	0.23
19	0.3
20	0.35
21	0.43
22	0.48
23	0.48
24	0.47
25	0.51
26	0.51
27	0.47
28	0.45
29	0.41
30	0.4
31	0.43
32	0.44
33	0.43
34	0.42
35	0.41
36	0.42
37	0.4
38	0.36
39	0.32
40	0.31
41	0.31
42	0.29
43	0.31
44	0.32
45	0.28
46	0.25
47	0.24
48	0.23
49	0.24
50	0.25
51	0.22
52	0.2
53	0.19
54	0.22
55	0.24
56	0.3
57	0.27
58	0.28
59	0.27
60	0.28
61	0.28
62	0.27
63	0.23
64	0.18
65	0.16
66	0.16
67	0.16
68	0.2
69	0.21
70	0.2
71	0.21
72	0.21
73	0.21
74	0.19
75	0.2
76	0.14
77	0.14
78	0.16
79	0.17
80	0.21
81	0.24
82	0.26
83	0.31
84	0.38
85	0.39
86	0.41
87	0.4
88	0.41
89	0.38
90	0.36
91	0.32
92	0.34
93	0.31
94	0.28
95	0.3
96	0.3
97	0.31
98	0.31
99	0.28
100	0.26
101	0.3
102	0.3
103	0.29
104	0.27
105	0.26
106	0.31
107	0.35
108	0.29
109	0.28
110	0.3
111	0.29
112	0.29
113	0.32
114	0.28
115	0.28
116	0.3
117	0.28
118	0.29
119	0.29
120	0.32
121	0.33
122	0.34
123	0.38
124	0.37
125	0.41
126	0.4
127	0.41
128	0.36
129	0.4
130	0.37
131	0.3
132	0.26
133	0.22
134	0.2
135	0.18
136	0.16
137	0.09
138	0.09
139	0.09
140	0.09
141	0.1
142	0.13
143	0.17
144	0.2
145	0.21
146	0.24
147	0.26
148	0.28
149	0.33
150	0.32
151	0.29
152	0.32
153	0.32
154	0.3
155	0.32
156	0.31
157	0.26
158	0.29
159	0.29
160	0.23
161	0.22
162	0.19
163	0.15
164	0.14
165	0.14
166	0.13
167	0.13
168	0.13
169	0.13
170	0.14
171	0.15
172	0.16
173	0.18
174	0.14
175	0.15
176	0.15
177	0.16
178	0.17
179	0.16
180	0.16
181	0.15
182	0.15
183	0.14
184	0.15
185	0.16
186	0.18
187	0.21
188	0.21
189	0.2
190	0.19
191	0.18
192	0.18
193	0.16
194	0.14
195	0.11
196	0.13
197	0.14
198	0.15
199	0.18
200	0.2
201	0.21
202	0.26
203	0.31
204	0.36
205	0.43
206	0.49
207	0.53
208	0.56
209	0.58
210	0.53
211	0.47
212	0.42
213	0.38
214	0.31
215	0.23
216	0.18
217	0.15
218	0.16
219	0.15
220	0.13
221	0.08
222	0.07
223	0.07
224	0.07
225	0.05
226	0.04
227	0.04
228	0.04
229	0.05
230	0.06
231	0.07
232	0.07
233	0.08
234	0.09
235	0.12
236	0.13
237	0.13
238	0.13
239	0.13
240	0.13
241	0.13
242	0.12
243	0.1
244	0.1
245	0.11
246	0.14
247	0.2
248	0.22
249	0.23
250	0.26
251	0.3
252	0.33
253	0.33
254	0.36
255	0.37
256	0.35
257	0.36
258	0.33
259	0.33
260	0.34
261	0.32
262	0.27
263	0.24
264	0.25
265	0.27
266	0.3
267	0.29
268	0.33
269	0.36
270	0.38
271	0.36
272	0.34
273	0.34
274	0.32
275	0.29
276	0.22
277	0.19
278	0.19
279	0.19
280	0.19
281	0.19
282	0.17
283	0.19
284	0.23
285	0.28
286	0.24
287	0.22
288	0.21
289	0.19
290	0.2
291	0.19
292	0.14
293	0.09
294	0.1
295	0.11
296	0.12
297	0.12
298	0.13
299	0.15
300	0.18
301	0.21
302	0.21
303	0.27
304	0.3
305	0.35
306	0.35
307	0.33
308	0.31
309	0.35
310	0.34
311	0.29
312	0.26
313	0.23
314	0.21
315	0.21
316	0.19
317	0.12
318	0.11
319	0.1
320	0.08
321	0.07
322	0.12
323	0.12
324	0.14
325	0.14
326	0.17
327	0.17
328	0.21
329	0.26
330	0.22
331	0.27
332	0.27
333	0.28
334	0.28
335	0.32
336	0.32
337	0.33
338	0.33
339	0.29
340	0.29
341	0.27
342	0.25
343	0.23
344	0.24
345	0.2
346	0.19
347	0.18
348	0.17
349	0.18
350	0.18
351	0.16
352	0.12
353	0.11
354	0.12
355	0.18
356	0.19
357	0.2
358	0.22
359	0.23
360	0.23
361	0.22
362	0.21
363	0.17
364	0.2
365	0.24
366	0.22
367	0.2
368	0.2
369	0.19
370	0.19
371	0.19
372	0.16
373	0.1
374	0.11
375	0.11
376	0.12
377	0.13
378	0.13
379	0.14
380	0.13
381	0.14
382	0.16
383	0.18
384	0.18
385	0.18
386	0.17
387	0.17
388	0.19
389	0.2
390	0.2
391	0.18
392	0.17
393	0.2
394	0.19
395	0.18
396	0.21
397	0.24
398	0.26
399	0.27
400	0.27
401	0.34
402	0.34
403	0.4
404	0.4
405	0.37
406	0.36
407	0.36
408	0.4
409	0.33
410	0.36
411	0.29
412	0.26
413	0.27
414	0.25
415	0.23
416	0.19
417	0.19
418	0.16
419	0.17
420	0.21
421	0.19
422	0.22
423	0.3
424	0.36
425	0.36
426	0.36
427	0.4
428	0.43
429	0.45
430	0.48
431	0.42
432	0.41
433	0.39
434	0.41
435	0.39
436	0.32
437	0.3
438	0.25
439	0.21
440	0.17
441	0.16
442	0.14
443	0.13
444	0.14
445	0.13
446	0.15
447	0.15
448	0.15
449	0.15
450	0.18
451	0.19
452	0.21
453	0.23
454	0.22
455	0.27
456	0.3
457	0.31
458	0.32
459	0.31
460	0.36
461	0.38
462	0.43
463	0.43
464	0.44
465	0.46
466	0.45
467	0.44
468	0.4
469	0.37
470	0.31
471	0.29
472	0.28
473	0.26
474	0.25
475	0.27
476	0.26
477	0.32
478	0.38
479	0.4
480	0.39
481	0.42
482	0.43
483	0.46
484	0.46
485	0.41
486	0.35
487	0.3
488	0.28
489	0.26
490	0.25
491	0.19
492	0.17
493	0.16
494	0.14
495	0.15
496	0.14
497	0.12
498	0.13
499	0.14
500	0.13
501	0.12
502	0.12
503	0.12
504	0.11
505	0.11
506	0.1
507	0.08
508	0.07
509	0.07
510	0.06
511	0.05
512	0.05
513	0.04
514	0.04
515	0.04
516	0.04
517	0.05
518	0.06
519	0.09
520	0.14
521	0.2
522	0.29
523	0.31
524	0.37
525	0.43
526	0.46
527	0.47
528	0.51
529	0.5
530	0.45
531	0.45
532	0.4
533	0.4
534	0.36
535	0.35
536	0.26
537	0.22
538	0.18
539	0.16
540	0.14
541	0.07
542	0.07
543	0.07
544	0.1
545	0.13
546	0.13
547	0.14
548	0.16
549	0.19
550	0.22
551	0.27
552	0.28
553	0.27
554	0.29
555	0.3
556	0.31
557	0.33
558	0.32
559	0.27
560	0.25
561	0.27
562	0.3
563	0.29
564	0.29
565	0.28
566	0.32
567	0.35
568	0.34
569	0.35
570	0.3
571	0.3
572	0.31
573	0.28
574	0.24
575	0.21
576	0.22
577	0.18
578	0.22
579	0.21
580	0.18
581	0.16
582	0.17
583	0.16
584	0.14
585	0.16
586	0.13
587	0.14
588	0.15
589	0.16
590	0.14
591	0.14
592	0.14
593	0.11
594	0.14
595	0.14
596	0.14
597	0.15
598	0.18
599	0.21
600	0.23
601	0.29
602	0.29
603	0.28
604	0.28
605	0.3
606	0.3
607	0.29
608	0.31
609	0.32
610	0.35
611	0.37
612	0.39
613	0.38
614	0.4
615	0.39
616	0.42
617	0.44
618	0.46
619	0.53
620	0.61
621	0.63
622	0.66
623	0.7
624	0.72
625	0.74
626	0.73
627	0.71
628	0.67
629	0.68
630	0.67
631	0.67
632	0.66
633	0.63
634	0.61
635	0.57
636	0.51
637	0.47
638	0.4
639	0.36
640	0.35
641	0.33
642	0.28
643	0.3
644	0.37
645	0.41
646	0.47
647	0.49
648	0.5
649	0.55
650	0.61
651	0.64
652	0.66
653	0.71
654	0.66
655	0.64
656	0.6
657	0.52
658	0.47
659	0.39
660	0.32
661	0.24
662	0.25
663	0.23
664	0.19
665	0.18
666	0.18
667	0.15
668	0.12
669	0.1
670	0.09
671	0.11
672	0.12
673	0.13
674	0.11
675	0.12
676	0.13
677	0.16
678	0.18
679	0.17
680	0.18
681	0.2
682	0.2
683	0.21
684	0.21
685	0.2
686	0.17
687	0.17
688	0.14
689	0.12
690	0.15
691	0.15
692	0.14
693	0.12
694	0.12
695	0.14
696	0.16
697	0.15
698	0.13
699	0.13
700	0.2
701	0.21
702	0.23
703	0.29
704	0.3
705	0.4
706	0.49
707	0.56
708	0.59
709	0.68
710	0.76
711	0.77
712	0.85
713	0.85
714	0.87
715	0.85
716	0.85
717	0.86
718	0.86
719	0.87
720	0.88
721	0.89
722	0.89
723	0.93
724	0.92
725	0.91
726	0.9
727	0.91
728	0.88
729	0.87
730	0.83
731	0.83
732	0.79
733	0.75
734	0.75
735	0.73
736	0.75
737	0.7
738	0.69
739	0.65
740	0.64
741	0.61
742	0.52
743	0.44
744	0.35
745	0.31
746	0.27
747	0.25
748	0.22
749	0.23
750	0.27
751	0.31
752	0.37
753	0.37
754	0.39
755	0.42
756	0.46
757	0.47
758	0.52
759	0.57
760	0.6
761	0.7
762	0.76
763	0.78
764	0.81
765	0.85
766	0.86
767	0.87
768	0.89
769	0.89
770	0.9
771	0.9
772	0.91
773	0.87
774	0.83
775	0.75
776	0.71
777	0.69
778	0.67
779	0.61
780	0.56
781	0.56
782	0.54
783	0.58
784	0.56
785	0.5
786	0.44
787	0.43
788	0.45
789	0.42
790	0.41
791	0.35
792	0.31
793	0.34
794	0.35
795	0.43
796	0.45
797	0.5
798	0.58
799	0.64
800	0.65
801	0.68
802	0.72
803	0.73
804	0.75
805	0.77
806	0.79
807	0.81
808	0.88
809	0.84
810	0.83
811	0.82
812	0.81
813	0.81
814	0.81
815	0.83
816	0.84

P39001

3D AlphaFold-predicted Structure Viewer