Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P39001

Protein Details
Accession P39001    Localization Confidence High Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
712-750SPDFAKSKGKNVKPKAKSKAKQSSKKRPNNTTSKSKANNHydrophilic
764-793GTRSRTGCWICRLRKKKCTEERPHCFNCERHydrophilic
807-836FVSDPKKKQMKLEEIKKKTKEAKRRAMKKKBasic
NLS Segment(s)
PositionSequence
717-739KSKGKNVKPKAKSKAKQSSKKRP
812-836KKKQMKLEEIKKKTKEAKRRAMKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 16
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0033698  C:Rpd3L complex  
GO:0070210  C:Rpd3L-Expanded complex  
GO:0005667  C:transcription regulator complex  
GO:0140297  F:DNA-binding transcription factor binding  
GO:0001227  F:DNA-binding transcription repressor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006338  P:chromatin remodeling  
GO:0034389  P:lipid droplet organization  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0010674  P:negative regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle  
GO:0001081  P:nitrogen catabolite repression of transcription from RNA polymerase II promoter  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0010673  P:positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle  
GO:0007124  P:pseudohyphal growth  
GO:0042173  P:regulation of sporulation resulting in formation of a cellular spore  
GO:0009847  P:spore germination  
KEGG sce:YDR207C  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MLDKARSQSKHMDESNAAASLLSMETTANNHHYLHNKTSRATLMNSSQDGKKHAEDEVSDGANSRHPTISSASIESLKTTYDENPLLSIMKSTCAPNNTPVHTPSGSPSLKVQSGGDIKDDPKENDTTTTTNTTLQDRRDSDNAVHAAASPLAPSNTPSDPKSLCNGHVAQATDPQISGAIQPQYTATNEDVFPYSSTSTNSNTATTTIVAGAKKKIHLPPPQAPAVSSPGTTAAGSGAGTGSGIRSRTGSDLPLIITSANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNNNEIGGYLRGGTKRGGSPSNDSQVQHNVHDDQCAVGVAPRNFYFNKDREITDPNVKLDENESKINISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQIPSQPPTSASSFTSTNNNNPQRNNINRGEDPFATSSRPSTGFFYGDLPNRNNRNSPFHTNEQYIPPPPPKYINSKLDGLRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDKPISNVNDMNNTNALGVPASRPHSSSFPSKGVLRPILLRIHNSEQQPIFESNNSTAVFDEDQDQNQDLSPYHLNLNSKKVLDPTFESRTRQVTWNKNGKRIDRRLSAPEQQQQLEVPPLKKSRRSVGNARVASQTNSDYNSLGESSTSSAPSSPSLKASSGLAYTADYPNATSPDFAKSKGKNVKPKAKSKAKQSSKKRPNNTTSKSKANNSQESNNATSSTSQGTRSRTGCWICRLRKKKCTEERPHCFNCERLKLDCHYDAFKPDFVSDPKKKQMKLEEIKKKTKEAKRRAMKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.39
4 0.32
5 0.23
6 0.2
7 0.15
8 0.14
9 0.1
10 0.07
11 0.06
12 0.07
13 0.09
14 0.13
15 0.15
16 0.17
17 0.18
18 0.23
19 0.3
20 0.35
21 0.43
22 0.48
23 0.48
24 0.47
25 0.51
26 0.51
27 0.47
28 0.45
29 0.41
30 0.4
31 0.43
32 0.44
33 0.43
34 0.42
35 0.41
36 0.42
37 0.4
38 0.36
39 0.32
40 0.31
41 0.31
42 0.29
43 0.31
44 0.32
45 0.28
46 0.25
47 0.24
48 0.23
49 0.24
50 0.25
51 0.22
52 0.2
53 0.19
54 0.22
55 0.24
56 0.3
57 0.27
58 0.28
59 0.27
60 0.28
61 0.28
62 0.27
63 0.23
64 0.18
65 0.16
66 0.16
67 0.16
68 0.2
69 0.21
70 0.2
71 0.21
72 0.21
73 0.21
74 0.19
75 0.2
76 0.14
77 0.14
78 0.16
79 0.17
80 0.21
81 0.24
82 0.26
83 0.31
84 0.38
85 0.39
86 0.41
87 0.4
88 0.41
89 0.38
90 0.36
91 0.32
92 0.34
93 0.31
94 0.28
95 0.3
96 0.3
97 0.31
98 0.31
99 0.28
100 0.26
101 0.3
102 0.3
103 0.29
104 0.27
105 0.26
106 0.31
107 0.35
108 0.29
109 0.28
110 0.3
111 0.29
112 0.29
113 0.32
114 0.28
115 0.28
116 0.3
117 0.28
118 0.29
119 0.29
120 0.32
121 0.33
122 0.34
123 0.38
124 0.37
125 0.41
126 0.4
127 0.41
128 0.36
129 0.4
130 0.37
131 0.3
132 0.26
133 0.22
134 0.2
135 0.18
136 0.16
137 0.09
138 0.09
139 0.09
140 0.09
141 0.1
142 0.13
143 0.17
144 0.2
145 0.21
146 0.24
147 0.26
148 0.28
149 0.33
150 0.32
151 0.29
152 0.32
153 0.32
154 0.3
155 0.32
156 0.31
157 0.26
158 0.29
159 0.29
160 0.23
161 0.22
162 0.19
163 0.15
164 0.14
165 0.14
166 0.13
167 0.13
168 0.13
169 0.13
170 0.14
171 0.15
172 0.16
173 0.18
174 0.14
175 0.15
176 0.15
177 0.16
178 0.17
179 0.16
180 0.16
181 0.15
182 0.15
183 0.14
184 0.15
185 0.16
186 0.18
187 0.21
188 0.21
189 0.2
190 0.19
191 0.18
192 0.18
193 0.16
194 0.14
195 0.11
196 0.13
197 0.14
198 0.15
199 0.18
200 0.2
201 0.21
202 0.26
203 0.31
204 0.36
205 0.43
206 0.49
207 0.53
208 0.56
209 0.58
210 0.53
211 0.47
212 0.42
213 0.38
214 0.31
215 0.23
216 0.18
217 0.15
218 0.16
219 0.15
220 0.13
221 0.08
222 0.07
223 0.07
224 0.07
225 0.05
226 0.04
227 0.04
228 0.04
229 0.05
230 0.06
231 0.07
232 0.07
233 0.08
234 0.09
235 0.12
236 0.13
237 0.13
238 0.13
239 0.13
240 0.13
241 0.13
242 0.12
243 0.1
244 0.1
245 0.11
246 0.14
247 0.2
248 0.22
249 0.23
250 0.26
251 0.3
252 0.33
253 0.33
254 0.36
255 0.37
256 0.35
257 0.36
258 0.33
259 0.33
260 0.34
261 0.32
262 0.27
263 0.24
264 0.25
265 0.27
266 0.3
267 0.29
268 0.33
269 0.36
270 0.38
271 0.36
272 0.34
273 0.34
274 0.32
275 0.29
276 0.22
277 0.19
278 0.19
279 0.19
280 0.19
281 0.19
282 0.17
283 0.19
284 0.23
285 0.28
286 0.24
287 0.22
288 0.21
289 0.19
290 0.2
291 0.19
292 0.14
293 0.09
294 0.1
295 0.11
296 0.12
297 0.12
298 0.13
299 0.15
300 0.18
301 0.21
302 0.21
303 0.27
304 0.3
305 0.35
306 0.35
307 0.33
308 0.31
309 0.35
310 0.34
311 0.29
312 0.26
313 0.23
314 0.21
315 0.21
316 0.19
317 0.12
318 0.11
319 0.1
320 0.08
321 0.07
322 0.12
323 0.12
324 0.14
325 0.14
326 0.17
327 0.17
328 0.21
329 0.26
330 0.22
331 0.27
332 0.27
333 0.28
334 0.28
335 0.32
336 0.32
337 0.33
338 0.33
339 0.29
340 0.29
341 0.27
342 0.25
343 0.23
344 0.24
345 0.2
346 0.19
347 0.18
348 0.17
349 0.18
350 0.18
351 0.16
352 0.12
353 0.11
354 0.12
355 0.18
356 0.19
357 0.2
358 0.22
359 0.23
360 0.23
361 0.22
362 0.21
363 0.17
364 0.2
365 0.24
366 0.22
367 0.2
368 0.2
369 0.19
370 0.19
371 0.19
372 0.16
373 0.1
374 0.11
375 0.11
376 0.12
377 0.13
378 0.13
379 0.14
380 0.13
381 0.14
382 0.16
383 0.18
384 0.18
385 0.18
386 0.17
387 0.17
388 0.19
389 0.2
390 0.2
391 0.18
392 0.17
393 0.2
394 0.19
395 0.18
396 0.21
397 0.24
398 0.26
399 0.27
400 0.27
401 0.34
402 0.34
403 0.4
404 0.4
405 0.37
406 0.36
407 0.36
408 0.4
409 0.33
410 0.36
411 0.29
412 0.26
413 0.27
414 0.25
415 0.23
416 0.19
417 0.19
418 0.16
419 0.17
420 0.21
421 0.19
422 0.22
423 0.3
424 0.36
425 0.36
426 0.36
427 0.4
428 0.43
429 0.45
430 0.48
431 0.42
432 0.41
433 0.39
434 0.41
435 0.39
436 0.32
437 0.3
438 0.25
439 0.21
440 0.17
441 0.16
442 0.14
443 0.13
444 0.14
445 0.13
446 0.15
447 0.15
448 0.15
449 0.15
450 0.18
451 0.19
452 0.21
453 0.23
454 0.22
455 0.27
456 0.3
457 0.31
458 0.32
459 0.31
460 0.36
461 0.38
462 0.43
463 0.43
464 0.44
465 0.46
466 0.45
467 0.44
468 0.4
469 0.37
470 0.31
471 0.29
472 0.28
473 0.26
474 0.25
475 0.27
476 0.26
477 0.32
478 0.38
479 0.4
480 0.39
481 0.42
482 0.43
483 0.46
484 0.46
485 0.41
486 0.35
487 0.3
488 0.28
489 0.26
490 0.25
491 0.19
492 0.17
493 0.16
494 0.14
495 0.15
496 0.14
497 0.12
498 0.13
499 0.14
500 0.13
501 0.12
502 0.12
503 0.12
504 0.11
505 0.11
506 0.1
507 0.08
508 0.07
509 0.07
510 0.06
511 0.05
512 0.05
513 0.04
514 0.04
515 0.04
516 0.04
517 0.05
518 0.06
519 0.09
520 0.14
521 0.2
522 0.29
523 0.31
524 0.37
525 0.43
526 0.46
527 0.47
528 0.51
529 0.5
530 0.45
531 0.45
532 0.4
533 0.4
534 0.36
535 0.35
536 0.26
537 0.22
538 0.18
539 0.16
540 0.14
541 0.07
542 0.07
543 0.07
544 0.1
545 0.13
546 0.13
547 0.14
548 0.16
549 0.19
550 0.22
551 0.27
552 0.28
553 0.27
554 0.29
555 0.3
556 0.31
557 0.33
558 0.32
559 0.27
560 0.25
561 0.27
562 0.3
563 0.29
564 0.29
565 0.28
566 0.32
567 0.35
568 0.34
569 0.35
570 0.3
571 0.3
572 0.31
573 0.28
574 0.24
575 0.21
576 0.22
577 0.18
578 0.22
579 0.21
580 0.18
581 0.16
582 0.17
583 0.16
584 0.14
585 0.16
586 0.13
587 0.14
588 0.15
589 0.16
590 0.14
591 0.14
592 0.14
593 0.11
594 0.14
595 0.14
596 0.14
597 0.15
598 0.18
599 0.21
600 0.23
601 0.29
602 0.29
603 0.28
604 0.28
605 0.3
606 0.3
607 0.29
608 0.31
609 0.32
610 0.35
611 0.37
612 0.39
613 0.38
614 0.4
615 0.39
616 0.42
617 0.44
618 0.46
619 0.53
620 0.61
621 0.63
622 0.66
623 0.7
624 0.72
625 0.74
626 0.73
627 0.71
628 0.67
629 0.68
630 0.67
631 0.67
632 0.66
633 0.63
634 0.61
635 0.57
636 0.51
637 0.47
638 0.4
639 0.36
640 0.35
641 0.33
642 0.28
643 0.3
644 0.37
645 0.41
646 0.47
647 0.49
648 0.5
649 0.55
650 0.61
651 0.64
652 0.66
653 0.71
654 0.66
655 0.64
656 0.6
657 0.52
658 0.47
659 0.39
660 0.32
661 0.24
662 0.25
663 0.23
664 0.19
665 0.18
666 0.18
667 0.15
668 0.12
669 0.1
670 0.09
671 0.11
672 0.12
673 0.13
674 0.11
675 0.12
676 0.13
677 0.16
678 0.18
679 0.17
680 0.18
681 0.2
682 0.2
683 0.21
684 0.21
685 0.2
686 0.17
687 0.17
688 0.14
689 0.12
690 0.15
691 0.15
692 0.14
693 0.12
694 0.12
695 0.14
696 0.16
697 0.15
698 0.13
699 0.13
700 0.2
701 0.21
702 0.23
703 0.29
704 0.3
705 0.4
706 0.49
707 0.56
708 0.59
709 0.68
710 0.76
711 0.77
712 0.85
713 0.85
714 0.87
715 0.85
716 0.85
717 0.86
718 0.86
719 0.87
720 0.88
721 0.89
722 0.89
723 0.93
724 0.92
725 0.91
726 0.9
727 0.91
728 0.88
729 0.87
730 0.83
731 0.83
732 0.79
733 0.75
734 0.75
735 0.73
736 0.75
737 0.7
738 0.69
739 0.65
740 0.64
741 0.61
742 0.52
743 0.44
744 0.35
745 0.31
746 0.27
747 0.25
748 0.22
749 0.23
750 0.27
751 0.31
752 0.37
753 0.37
754 0.39
755 0.42
756 0.46
757 0.47
758 0.52
759 0.57
760 0.6
761 0.7
762 0.76
763 0.78
764 0.81
765 0.85
766 0.86
767 0.87
768 0.89
769 0.89
770 0.9
771 0.9
772 0.91
773 0.87
774 0.83
775 0.75
776 0.71
777 0.69
778 0.67
779 0.61
780 0.56
781 0.56
782 0.54
783 0.58
784 0.56
785 0.5
786 0.44
787 0.43
788 0.45
789 0.42
790 0.41
791 0.35
792 0.31
793 0.34
794 0.35
795 0.43
796 0.45
797 0.5
798 0.58
799 0.64
800 0.65
801 0.68
802 0.72
803 0.73
804 0.75
805 0.77
806 0.79
807 0.81
808 0.88
809 0.84
810 0.83
811 0.82
812 0.81
813 0.81
814 0.81
815 0.83
816 0.84