Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38130

Protein Details
Accession P38130   
Localization Confidence Low
Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
255-276ETTKKFIKKNPKFLHKNNLMKFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 6.5, golg 6, plas 4, E.R. 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002685  Glyco_trans_15  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000324  C:fungal-type vacuole  
GO:0000329  C:fungal-type vacuole membrane  
GO:0005794  C:Golgi apparatus  
GO:0005634  C:nucleus  
GO:0000026  F:alpha-1,2-mannosyltransferase activity  
GO:0000030  F:mannosyltransferase activity  
GO:0000032  P:cell wall mannoprotein biosynthetic process  
GO:0097502  P:mannosylation  
GO:0006491  P:N-glycan processing  
GO:0006487  P:protein N-linked glycosylation  
GO:0006493  P:protein O-linked glycosylation  
KEGG sce:YBR205W  -  
Pfam View protein in Pfam  
PF01793  Glyco_transf_15  
Amino Acid Sequences MSVHHKKKLMPKSALLIRKYQKGIRSSFIGLIIVLSFLFFMSGSRSPEVPIAQGTSVSRVASKDYLMPFTDKSQGVIHPVDDGKKEKGVMVTLARNSDLWNLVKSIRHVEDRFNNRYHYDWVFLNDQPFSDEFKRVTSALVSGKAKYGTIPKDHWSIPSWIDTEKFDEKRLAMGKLDIPYGSSVPYRHMCRFQSGFIWRHPLLEEYEWFWRVDTDITLFCDIQYDIFKFLKVNNKKYGFILSVSEYERTIPTLWETTKKFIKKNPKFLHKNNLMKFISNDDGDTYNMCHFWTNFEIGSLDFFRSDAYREYFDYLDSSGGFFYERWGDAPVHSIAASLFLDKSEIHFFDGLGFHHPDFTSCPIEQKIRLQNKCICEPSKDVTWTPDYFCTRKYFSAGNYKLPPGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.66
3 0.65
4 0.61
5 0.63
6 0.63
7 0.59
8 0.57
9 0.57
10 0.59
11 0.54
12 0.53
13 0.48
14 0.45
15 0.41
16 0.35
17 0.27
18 0.23
19 0.18
20 0.13
21 0.09
22 0.07
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.09
29 0.13
30 0.17
31 0.19
32 0.19
33 0.2
34 0.24
35 0.25
36 0.21
37 0.19
38 0.18
39 0.17
40 0.19
41 0.18
42 0.18
43 0.19
44 0.17
45 0.17
46 0.15
47 0.19
48 0.18
49 0.18
50 0.21
51 0.21
52 0.24
53 0.24
54 0.26
55 0.24
56 0.26
57 0.31
58 0.26
59 0.25
60 0.25
61 0.24
62 0.27
63 0.26
64 0.23
65 0.21
66 0.23
67 0.23
68 0.24
69 0.27
70 0.24
71 0.25
72 0.26
73 0.23
74 0.23
75 0.22
76 0.22
77 0.23
78 0.26
79 0.26
80 0.27
81 0.25
82 0.23
83 0.23
84 0.22
85 0.21
86 0.17
87 0.16
88 0.17
89 0.19
90 0.21
91 0.22
92 0.25
93 0.25
94 0.3
95 0.3
96 0.36
97 0.43
98 0.49
99 0.52
100 0.49
101 0.48
102 0.42
103 0.43
104 0.41
105 0.33
106 0.28
107 0.23
108 0.24
109 0.25
110 0.25
111 0.25
112 0.2
113 0.18
114 0.18
115 0.17
116 0.19
117 0.18
118 0.19
119 0.18
120 0.19
121 0.21
122 0.19
123 0.19
124 0.15
125 0.16
126 0.15
127 0.2
128 0.2
129 0.18
130 0.2
131 0.2
132 0.19
133 0.18
134 0.22
135 0.2
136 0.24
137 0.26
138 0.27
139 0.31
140 0.31
141 0.31
142 0.28
143 0.26
144 0.23
145 0.24
146 0.22
147 0.18
148 0.19
149 0.18
150 0.2
151 0.24
152 0.24
153 0.22
154 0.23
155 0.22
156 0.26
157 0.28
158 0.24
159 0.17
160 0.18
161 0.2
162 0.19
163 0.19
164 0.14
165 0.12
166 0.12
167 0.12
168 0.11
169 0.09
170 0.09
171 0.12
172 0.16
173 0.19
174 0.21
175 0.26
176 0.26
177 0.3
178 0.31
179 0.29
180 0.3
181 0.32
182 0.32
183 0.28
184 0.33
185 0.28
186 0.27
187 0.26
188 0.22
189 0.19
190 0.17
191 0.17
192 0.12
193 0.15
194 0.15
195 0.14
196 0.13
197 0.11
198 0.1
199 0.1
200 0.09
201 0.08
202 0.08
203 0.09
204 0.11
205 0.1
206 0.1
207 0.1
208 0.1
209 0.09
210 0.1
211 0.09
212 0.11
213 0.12
214 0.12
215 0.12
216 0.15
217 0.24
218 0.29
219 0.35
220 0.41
221 0.43
222 0.44
223 0.45
224 0.44
225 0.36
226 0.3
227 0.26
228 0.19
229 0.19
230 0.19
231 0.18
232 0.15
233 0.15
234 0.14
235 0.13
236 0.12
237 0.09
238 0.1
239 0.13
240 0.15
241 0.2
242 0.22
243 0.26
244 0.32
245 0.36
246 0.38
247 0.42
248 0.52
249 0.55
250 0.64
251 0.69
252 0.72
253 0.77
254 0.79
255 0.83
256 0.81
257 0.81
258 0.74
259 0.74
260 0.64
261 0.56
262 0.51
263 0.45
264 0.38
265 0.28
266 0.25
267 0.17
268 0.18
269 0.17
270 0.16
271 0.13
272 0.11
273 0.11
274 0.11
275 0.11
276 0.1
277 0.13
278 0.15
279 0.16
280 0.15
281 0.15
282 0.16
283 0.14
284 0.17
285 0.14
286 0.12
287 0.1
288 0.1
289 0.1
290 0.1
291 0.12
292 0.13
293 0.15
294 0.17
295 0.18
296 0.21
297 0.2
298 0.2
299 0.2
300 0.16
301 0.14
302 0.12
303 0.11
304 0.08
305 0.08
306 0.09
307 0.07
308 0.09
309 0.11
310 0.11
311 0.12
312 0.15
313 0.15
314 0.15
315 0.19
316 0.17
317 0.15
318 0.14
319 0.14
320 0.11
321 0.13
322 0.13
323 0.1
324 0.09
325 0.08
326 0.1
327 0.09
328 0.13
329 0.15
330 0.16
331 0.17
332 0.17
333 0.17
334 0.2
335 0.21
336 0.19
337 0.19
338 0.2
339 0.18
340 0.21
341 0.21
342 0.18
343 0.2
344 0.24
345 0.24
346 0.22
347 0.27
348 0.29
349 0.33
350 0.35
351 0.41
352 0.47
353 0.52
354 0.56
355 0.58
356 0.61
357 0.63
358 0.68
359 0.66
360 0.59
361 0.53
362 0.55
363 0.53
364 0.54
365 0.51
366 0.45
367 0.43
368 0.46
369 0.44
370 0.41
371 0.44
372 0.43
373 0.41
374 0.43
375 0.44
376 0.43
377 0.43
378 0.44
379 0.4
380 0.41
381 0.5
382 0.5
383 0.53
384 0.53