Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P23369

Protein Details
Accession P23369    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
133-156IASKKGSKYAKRVEKMKKNQSIGWHydrophilic
NLS Segment(s)
PositionSequence
106-150PKGHKHELKLNEKLKKREEALKKVDELIASKKGSKYAKRVEKMKK
Subcellular Location(s) mito 15, mito_nucl 13.5, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG sce:YGR076C  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSYKQYFDSLPLKLKSFFQRYPPSIKYSPVSTSTKAINANPFLPNKHPVTQRFHDPKYSLRRMSDVYKLALRYGVEEFLPPIENTKKLFFEEKYNKKTLMKGVLLPKGHKHELKLNEKLKKREEALKKVDELIASKKGSKYAKRVEKMKKNQSIGWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.47
4 0.46
5 0.48
6 0.55
7 0.56
8 0.63
9 0.61
10 0.59
11 0.53
12 0.54
13 0.47
14 0.41
15 0.41
16 0.38
17 0.39
18 0.33
19 0.34
20 0.32
21 0.33
22 0.32
23 0.3
24 0.3
25 0.28
26 0.29
27 0.3
28 0.3
29 0.29
30 0.3
31 0.32
32 0.3
33 0.34
34 0.38
35 0.39
36 0.45
37 0.46
38 0.53
39 0.56
40 0.54
41 0.52
42 0.48
43 0.5
44 0.52
45 0.56
46 0.48
47 0.42
48 0.42
49 0.4
50 0.42
51 0.4
52 0.32
53 0.27
54 0.26
55 0.26
56 0.23
57 0.22
58 0.18
59 0.14
60 0.13
61 0.11
62 0.09
63 0.09
64 0.09
65 0.08
66 0.09
67 0.07
68 0.09
69 0.1
70 0.12
71 0.13
72 0.16
73 0.16
74 0.17
75 0.2
76 0.18
77 0.27
78 0.36
79 0.43
80 0.46
81 0.48
82 0.48
83 0.46
84 0.48
85 0.43
86 0.4
87 0.33
88 0.33
89 0.37
90 0.41
91 0.41
92 0.39
93 0.39
94 0.38
95 0.41
96 0.38
97 0.34
98 0.37
99 0.44
100 0.51
101 0.55
102 0.57
103 0.6
104 0.66
105 0.7
106 0.67
107 0.64
108 0.6
109 0.6
110 0.62
111 0.63
112 0.64
113 0.62
114 0.58
115 0.54
116 0.51
117 0.43
118 0.36
119 0.32
120 0.3
121 0.27
122 0.29
123 0.29
124 0.34
125 0.4
126 0.44
127 0.49
128 0.53
129 0.62
130 0.67
131 0.75
132 0.79
133 0.82
134 0.86
135 0.88
136 0.87
137 0.81