Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q08492

Protein Details
Accession Q08492   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-98QSQLRSKRRKQNELYAKQKKSHydrophilic
150-176ALAKAIKTKKRKTLKNLRKDSVKRGKFHydrophilic
NLS Segment(s)
PositionSequence
153-175KAIKTKKRKTLKNLRKDSVKRGK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013268  U3_snoRNA_assoc  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0034511  F:U3 snoRNA binding  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0030490  P:maturation of SSU-rRNA  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG sce:YOR078W  -  
Pfam View protein in Pfam  
PF08297  U3_snoRNA_assoc  
Amino Acid Sequences MSNGHVKFDADESQASASAVTDRQDDVLVISKKDKEVHSSSDEESDDDDAPQEEGLHSGKSEVESQITQREEAIRLEQSQLRSKRRKQNELYAKQKKSVNETEVTDEVIAELPEELLKNIDQKDEGSTQYSSSRHVTFDKLDESDENEEALAKAIKTKKRKTLKNLRKDSVKRGKFRVQLLSTTQDSKTLPPKKESSIIRSKDRWLNRKALNKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.11
5 0.11
6 0.12
7 0.12
8 0.12
9 0.12
10 0.13
11 0.13
12 0.13
13 0.12
14 0.19
15 0.2
16 0.2
17 0.23
18 0.25
19 0.27
20 0.31
21 0.31
22 0.29
23 0.32
24 0.36
25 0.37
26 0.38
27 0.37
28 0.37
29 0.35
30 0.29
31 0.26
32 0.22
33 0.18
34 0.15
35 0.14
36 0.1
37 0.1
38 0.1
39 0.09
40 0.06
41 0.08
42 0.09
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1
48 0.11
49 0.1
50 0.12
51 0.12
52 0.13
53 0.18
54 0.19
55 0.17
56 0.16
57 0.18
58 0.17
59 0.17
60 0.19
61 0.14
62 0.15
63 0.17
64 0.19
65 0.2
66 0.27
67 0.33
68 0.4
69 0.47
70 0.54
71 0.62
72 0.69
73 0.75
74 0.72
75 0.76
76 0.78
77 0.79
78 0.81
79 0.81
80 0.73
81 0.68
82 0.66
83 0.57
84 0.52
85 0.48
86 0.41
87 0.34
88 0.33
89 0.32
90 0.29
91 0.28
92 0.21
93 0.15
94 0.12
95 0.09
96 0.08
97 0.04
98 0.04
99 0.03
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.08
106 0.08
107 0.09
108 0.09
109 0.1
110 0.13
111 0.14
112 0.14
113 0.14
114 0.14
115 0.14
116 0.18
117 0.18
118 0.17
119 0.18
120 0.19
121 0.18
122 0.19
123 0.21
124 0.19
125 0.21
126 0.21
127 0.19
128 0.19
129 0.17
130 0.19
131 0.19
132 0.18
133 0.15
134 0.12
135 0.12
136 0.11
137 0.12
138 0.09
139 0.07
140 0.12
141 0.19
142 0.26
143 0.35
144 0.42
145 0.51
146 0.6
147 0.69
148 0.74
149 0.79
150 0.83
151 0.85
152 0.87
153 0.84
154 0.85
155 0.81
156 0.81
157 0.81
158 0.79
159 0.74
160 0.72
161 0.74
162 0.7
163 0.7
164 0.69
165 0.61
166 0.57
167 0.55
168 0.53
169 0.47
170 0.44
171 0.38
172 0.32
173 0.3
174 0.3
175 0.36
176 0.39
177 0.4
178 0.44
179 0.48
180 0.5
181 0.57
182 0.58
183 0.57
184 0.59
185 0.61
186 0.63
187 0.62
188 0.65
189 0.66
190 0.7
191 0.7
192 0.65
193 0.68
194 0.69