Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q07541

Protein Details
Accession Q07541    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-148LDERREEEKKLKKYNGKKNEAYEGFBasic
NLS Segment(s)
Subcellular Location(s) cyto 12, mito 6, cyto_pero 6, nucl 4
Family & Domain DBs
Gene Ontology GO:0030663  C:COPI-coated vesicle membrane  
GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0012507  C:ER to Golgi transport vesicle membrane  
GO:0000139  C:Golgi membrane  
KEGG sce:YDL121C  -  
Amino Acid Sequences MNLYGYFLLLIIVIAFIALLPLFSGIGTFKLTKPKSSATAQSATGKLGKREYLKKKLDHTNVLKFDLKDTEESLGHDSASASSASRKFEIDSKTGLKRRVIGQYNKDPNDFDFDIDDLINEDELDERREEEKKLKKYNGKKNEAYEGFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.04
12 0.04
13 0.06
14 0.09
15 0.1
16 0.12
17 0.22
18 0.23
19 0.26
20 0.29
21 0.32
22 0.35
23 0.37
24 0.42
25 0.37
26 0.39
27 0.38
28 0.39
29 0.35
30 0.32
31 0.32
32 0.27
33 0.24
34 0.23
35 0.25
36 0.27
37 0.36
38 0.44
39 0.49
40 0.54
41 0.57
42 0.62
43 0.67
44 0.66
45 0.66
46 0.63
47 0.61
48 0.57
49 0.56
50 0.52
51 0.43
52 0.38
53 0.32
54 0.27
55 0.19
56 0.17
57 0.15
58 0.13
59 0.14
60 0.14
61 0.12
62 0.11
63 0.1
64 0.09
65 0.07
66 0.08
67 0.07
68 0.05
69 0.08
70 0.1
71 0.12
72 0.12
73 0.13
74 0.13
75 0.18
76 0.21
77 0.2
78 0.22
79 0.25
80 0.31
81 0.35
82 0.38
83 0.34
84 0.34
85 0.36
86 0.42
87 0.45
88 0.45
89 0.49
90 0.56
91 0.64
92 0.62
93 0.59
94 0.51
95 0.44
96 0.44
97 0.37
98 0.27
99 0.2
100 0.18
101 0.18
102 0.17
103 0.16
104 0.09
105 0.09
106 0.08
107 0.06
108 0.06
109 0.08
110 0.09
111 0.11
112 0.1
113 0.12
114 0.15
115 0.18
116 0.21
117 0.28
118 0.37
119 0.44
120 0.54
121 0.61
122 0.68
123 0.76
124 0.84
125 0.86
126 0.86
127 0.83
128 0.8
129 0.81