Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P24000

Protein Details
Accession P24000   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-129RKANREEKLKANKEKKRAEKAARKAEKAKBasic
NLS Segment(s)
PositionSequence
43-132RKNPRRIAWTVLFRKHHKKGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEVRKANREEKLKANKEKKRAEKAARKAEKAKSAG
Subcellular Location(s) nucl 16.5, mito_nucl 12, mito 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003729  F:mRNA binding  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG sce:YGR148C  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHKKGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEVRKANREEKLKANKEKKRAEKAARKAEKAKSAGVQGSKVSKQQAKGAFQKVAATSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.2
4 0.23
5 0.26
6 0.29
7 0.29
8 0.29
9 0.3
10 0.28
11 0.28
12 0.28
13 0.29
14 0.32
15 0.3
16 0.31
17 0.34
18 0.34
19 0.41
20 0.42
21 0.42
22 0.35
23 0.38
24 0.36
25 0.43
26 0.5
27 0.47
28 0.52
29 0.6
30 0.68
31 0.71
32 0.77
33 0.73
34 0.74
35 0.72
36 0.69
37 0.65
38 0.65
39 0.64
40 0.63
41 0.61
42 0.58
43 0.63
44 0.62
45 0.61
46 0.54
47 0.51
48 0.5
49 0.54
50 0.56
51 0.54
52 0.56
53 0.58
54 0.6
55 0.59
56 0.56
57 0.5
58 0.52
59 0.52
60 0.5
61 0.53
62 0.59
63 0.66
64 0.73
65 0.72
66 0.67
67 0.62
68 0.57
69 0.47
70 0.37
71 0.26
72 0.17
73 0.15
74 0.11
75 0.11
76 0.11
77 0.1
78 0.14
79 0.16
80 0.19
81 0.22
82 0.27
83 0.34
84 0.43
85 0.51
86 0.58
87 0.63
88 0.66
89 0.68
90 0.73
91 0.71
92 0.66
93 0.62
94 0.61
95 0.64
96 0.66
97 0.71
98 0.7
99 0.7
100 0.74
101 0.8
102 0.8
103 0.8
104 0.81
105 0.81
106 0.81
107 0.85
108 0.86
109 0.84
110 0.8
111 0.77
112 0.75
113 0.72
114 0.65
115 0.58
116 0.5
117 0.47
118 0.47
119 0.41
120 0.36
121 0.31
122 0.35
123 0.33
124 0.33
125 0.36
126 0.36
127 0.36
128 0.42
129 0.46
130 0.48
131 0.54
132 0.57
133 0.53
134 0.49
135 0.51