FuNGI

P42073

Protein Details

Accession

P42073

Localization Confidence

Medium

Confidence Score

12.9

NoLS Segment(s)

Position	Sequence	Protein Nature
513-533	GLPYKHVPIVKRNKYPPRPVH	Hydrophilic

NLS Segment(s)

Position	Sequence
195-231	NLKKKLASSKAKIKDSEKEKEKEKDKSKVKMKTKLKP

Subcellular Location(s)

nucl 19, cyto_nucl 13.5, cyto 6

Family & Domain DBs

Gene Ontology

GO:0005829  C:cytosol
GO:0005847  C:mRNA cleavage and polyadenylation specificity factor complex
GO:0005634  C:nucleus
GO:0003682  F:chromatin binding
GO:0003723  F:RNA binding
GO:0031124  P:mRNA 3'-end processing
GO:0006378  P:mRNA polyadenylation
GO:1900364  P:negative regulation of mRNA polyadenylation
GO:1903501  P:positive regulation of mitotic actomyosin contractile ring assembly
GO:0098789  P:pre-mRNA cleavage required for polyadenylation
GO:1901901  P:regulation of protein localization to cell division site involved in cytokinesis
GO:0031126  P:sno(s)RNA 3'-end processing
GO:0030846  P:termination of RNA polymerase II transcription, poly(A)-coupled

KEGG

sce:YDR195W -

Amino Acid Sequences

MSAPVPQLVNISHALQASTIQQIRLDMVDFNKDCKLSSIQLARIDKYIDSLQAALNQFTKDNLHIERKEKNVTEADIQLYSGLKSMYLDYLNQLIKLKHEKQHHSTPPIANDVSLDFFVNQLPKFSPEERKNYIDNLILNKNSHNRLSKMDGLVDAVINLCVLDTSVAENVRSYMKLLDTLGFQKGSNSTGTKANLKKKLASSKAKIKDSEKEKEKEKDKSKVKMKTKLKPSPLLNNDDKNSSPSPTASTSSMKKLKSGLFNKNEAKSTESLPTSSKKKLSFSKYLNKDDADMTKLGTKRSIDVDFKVNPEASTVASNIISSSTSGSSTTTVATPASSEEPLKKKTKISVQDSNVQSILRNGKPKKARISSIKFLDDSQLIKVYGDDLPNQGLQVSPTQLKKILKPFKEGEPKEIILFEDMSIKLKPLDLMFLKNTNSDDYMDISETKGGPIHCETRTPLIYRKNFNHFNPDLNKRPPREPIEFDLNGNTNSTPTIAKAFGKNSLLLRKDRGGLPYKHVPIVKRNKYPPRPVH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.18
2	0.15
3	0.16
4	0.16
5	0.21
6	0.21
7	0.19
8	0.2
9	0.2
10	0.22
11	0.21
12	0.2
13	0.16
14	0.16
15	0.25
16	0.25
17	0.27
18	0.29
19	0.28
20	0.28
21	0.29
22	0.31
23	0.25
24	0.33
25	0.37
26	0.38
27	0.46
28	0.49
29	0.47
30	0.44
31	0.43
32	0.34
33	0.31
34	0.28
35	0.22
36	0.19
37	0.19
38	0.18
39	0.23
40	0.24
41	0.22
42	0.22
43	0.21
44	0.2
45	0.21
46	0.22
47	0.18
48	0.21
49	0.26
50	0.32
51	0.37
52	0.42
53	0.47
54	0.5
55	0.56
56	0.52
57	0.51
58	0.46
59	0.44
60	0.43
61	0.39
62	0.36
63	0.29
64	0.27
65	0.23
66	0.19
67	0.16
68	0.13
69	0.1
70	0.08
71	0.08
72	0.1
73	0.12
74	0.12
75	0.12
76	0.13
77	0.19
78	0.19
79	0.2
80	0.22
81	0.2
82	0.24
83	0.33
84	0.37
85	0.38
86	0.47
87	0.53
88	0.58
89	0.68
90	0.71
91	0.67
92	0.68
93	0.65
94	0.6
95	0.57
96	0.5
97	0.39
98	0.32
99	0.28
100	0.22
101	0.18
102	0.15
103	0.1
104	0.1
105	0.12
106	0.15
107	0.13
108	0.14
109	0.14
110	0.17
111	0.21
112	0.25
113	0.33
114	0.37
115	0.45
116	0.48
117	0.51
118	0.5
119	0.48
120	0.47
121	0.4
122	0.36
123	0.34
124	0.33
125	0.31
126	0.3
127	0.31
128	0.34
129	0.34
130	0.36
131	0.36
132	0.33
133	0.36
134	0.4
135	0.42
136	0.37
137	0.35
138	0.3
139	0.26
140	0.25
141	0.2
142	0.14
143	0.09
144	0.08
145	0.06
146	0.05
147	0.04
148	0.03
149	0.03
150	0.03
151	0.03
152	0.05
153	0.07
154	0.08
155	0.08
156	0.08
157	0.09
158	0.11
159	0.11
160	0.1
161	0.1
162	0.1
163	0.11
164	0.12
165	0.12
166	0.12
167	0.14
168	0.15
169	0.15
170	0.14
171	0.14
172	0.14
173	0.14
174	0.15
175	0.14
176	0.14
177	0.18
178	0.2
179	0.26
180	0.32
181	0.39
182	0.44
183	0.45
184	0.47
185	0.49
186	0.57
187	0.58
188	0.6
189	0.58
190	0.61
191	0.67
192	0.67
193	0.64
194	0.58
195	0.58
196	0.56
197	0.59
198	0.56
199	0.52
200	0.54
201	0.58
202	0.62
203	0.63
204	0.63
205	0.64
206	0.64
207	0.69
208	0.71
209	0.73
210	0.75
211	0.75
212	0.76
213	0.75
214	0.78
215	0.77
216	0.74
217	0.72
218	0.68
219	0.68
220	0.64
221	0.62
222	0.56
223	0.52
224	0.47
225	0.42
226	0.38
227	0.32
228	0.28
229	0.23
230	0.19
231	0.15
232	0.17
233	0.17
234	0.18
235	0.16
236	0.19
237	0.19
238	0.26
239	0.31
240	0.28
241	0.27
242	0.29
243	0.31
244	0.37
245	0.42
246	0.44
247	0.43
248	0.5
249	0.53
250	0.51
251	0.49
252	0.41
253	0.36
254	0.28
255	0.26
256	0.23
257	0.2
258	0.18
259	0.18
260	0.22
261	0.23
262	0.25
263	0.27
264	0.25
265	0.3
266	0.37
267	0.42
268	0.46
269	0.49
270	0.55
271	0.58
272	0.61
273	0.59
274	0.51
275	0.46
276	0.39
277	0.34
278	0.27
279	0.19
280	0.15
281	0.17
282	0.18
283	0.17
284	0.18
285	0.16
286	0.16
287	0.19
288	0.23
289	0.21
290	0.21
291	0.26
292	0.25
293	0.26
294	0.26
295	0.22
296	0.18
297	0.17
298	0.16
299	0.11
300	0.11
301	0.1
302	0.09
303	0.08
304	0.08
305	0.08
306	0.07
307	0.07
308	0.06
309	0.07
310	0.06
311	0.07
312	0.07
313	0.08
314	0.08
315	0.09
316	0.09
317	0.08
318	0.08
319	0.08
320	0.07
321	0.07
322	0.08
323	0.09
324	0.09
325	0.1
326	0.16
327	0.2
328	0.26
329	0.3
330	0.31
331	0.32
332	0.38
333	0.45
334	0.48
335	0.51
336	0.55
337	0.54
338	0.61
339	0.59
340	0.55
341	0.47
342	0.38
343	0.3
344	0.25
345	0.28
346	0.23
347	0.31
348	0.3
349	0.38
350	0.45
351	0.51
352	0.57
353	0.56
354	0.6
355	0.61
356	0.68
357	0.68
358	0.67
359	0.63
360	0.54
361	0.49
362	0.44
363	0.36
364	0.28
365	0.22
366	0.19
367	0.16
368	0.15
369	0.15
370	0.14
371	0.14
372	0.14
373	0.14
374	0.12
375	0.14
376	0.14
377	0.14
378	0.12
379	0.1
380	0.1
381	0.11
382	0.12
383	0.15
384	0.16
385	0.18
386	0.24
387	0.26
388	0.31
389	0.39
390	0.46
391	0.44
392	0.5
393	0.51
394	0.56
395	0.64
396	0.6
397	0.55
398	0.52
399	0.5
400	0.45
401	0.42
402	0.32
403	0.23
404	0.22
405	0.17
406	0.15
407	0.14
408	0.16
409	0.15
410	0.15
411	0.14
412	0.14
413	0.15
414	0.11
415	0.17
416	0.17
417	0.21
418	0.24
419	0.27
420	0.27
421	0.28
422	0.29
423	0.24
424	0.24
425	0.21
426	0.19
427	0.18
428	0.19
429	0.18
430	0.17
431	0.16
432	0.17
433	0.16
434	0.15
435	0.15
436	0.14
437	0.16
438	0.2
439	0.25
440	0.23
441	0.26
442	0.28
443	0.33
444	0.36
445	0.36
446	0.39
447	0.44
448	0.5
449	0.56
450	0.6
451	0.62
452	0.66
453	0.65
454	0.68
455	0.6
456	0.61
457	0.61
458	0.62
459	0.61
460	0.63
461	0.68
462	0.63
463	0.67
464	0.68
465	0.67
466	0.66
467	0.64
468	0.61
469	0.62
470	0.59
471	0.54
472	0.51
473	0.46
474	0.39
475	0.34
476	0.27
477	0.19
478	0.18
479	0.18
480	0.13
481	0.12
482	0.15
483	0.16
484	0.19
485	0.24
486	0.26
487	0.31
488	0.33
489	0.35
490	0.37
491	0.43
492	0.44
493	0.43
494	0.46
495	0.44
496	0.46
497	0.46
498	0.48
499	0.48
500	0.47
501	0.51
502	0.55
503	0.55
504	0.56
505	0.56
506	0.53
507	0.55
508	0.62
509	0.64
510	0.65
511	0.71
512	0.77
513	0.83

P42073

3D AlphaFold-predicted Structure Viewer