Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P36531

Protein Details
Accession P36531    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
125-144LSEENKKKTQIKKEEKEDVSHydrophilic
NLS Segment(s)
PositionSequence
168-177KLASKKRDKK
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG sce:YBR122C  -  
Amino Acid Sequences MLKSIFAKRFASTGSYPGSTRITLPRRPAKKIQLGKSRPAIYHQFNVKMELSDGSVVIRRSQYPKGEIRLIQDQRNNPLWNPSRDDLVVVDANSGGSLDRFNKRYSSLFSVDSTTPNSSSETVELSEENKKKTQIKKEEKEDVSEKAFGMDDYLSLLDDSEQQIKSGKLASKKRDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.27
5 0.29
6 0.23
7 0.25
8 0.3
9 0.32
10 0.36
11 0.45
12 0.52
13 0.55
14 0.61
15 0.67
16 0.67
17 0.71
18 0.75
19 0.75
20 0.76
21 0.75
22 0.76
23 0.75
24 0.7
25 0.6
26 0.56
27 0.53
28 0.47
29 0.49
30 0.47
31 0.45
32 0.41
33 0.44
34 0.39
35 0.32
36 0.29
37 0.22
38 0.18
39 0.13
40 0.12
41 0.09
42 0.11
43 0.11
44 0.12
45 0.13
46 0.14
47 0.18
48 0.22
49 0.25
50 0.27
51 0.32
52 0.34
53 0.37
54 0.36
55 0.36
56 0.41
57 0.41
58 0.4
59 0.4
60 0.38
61 0.39
62 0.43
63 0.39
64 0.3
65 0.36
66 0.36
67 0.34
68 0.37
69 0.33
70 0.29
71 0.28
72 0.28
73 0.19
74 0.17
75 0.15
76 0.1
77 0.1
78 0.08
79 0.07
80 0.07
81 0.06
82 0.04
83 0.03
84 0.04
85 0.07
86 0.11
87 0.13
88 0.14
89 0.15
90 0.18
91 0.2
92 0.23
93 0.26
94 0.25
95 0.25
96 0.25
97 0.27
98 0.26
99 0.25
100 0.23
101 0.19
102 0.16
103 0.16
104 0.16
105 0.14
106 0.14
107 0.14
108 0.12
109 0.11
110 0.12
111 0.11
112 0.12
113 0.19
114 0.21
115 0.24
116 0.25
117 0.29
118 0.36
119 0.44
120 0.52
121 0.55
122 0.63
123 0.7
124 0.76
125 0.81
126 0.76
127 0.74
128 0.67
129 0.6
130 0.52
131 0.43
132 0.35
133 0.26
134 0.25
135 0.18
136 0.16
137 0.12
138 0.09
139 0.09
140 0.09
141 0.08
142 0.08
143 0.08
144 0.07
145 0.09
146 0.12
147 0.15
148 0.15
149 0.16
150 0.19
151 0.19
152 0.2
153 0.24
154 0.27
155 0.31
156 0.4
157 0.5