Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P36053

Protein Details
Accession P36053    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKRKKSTRKPTKRLVQKLDTKFNCHydrophilic
NLS Segment(s)
PositionSequence
3-14KRKKSTRKPTKR
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0045815  P:transcription initiation-coupled chromatin remodeling  
KEGG sce:YKL160W  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSTRKPTKRLVQKLDTKFNCLFCNHEKSVSCTLDKKNSIGTLSCKICGQSFQTRINSLSQPVDVYSDWFDAVEEVNSGRGSDTDDGDEGSDSDYESDSEQDAKTQNDGEIDSDEEEVDSDEERIGQVKRGRGALVDSDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.9
3 0.88
4 0.87
5 0.86
6 0.86
7 0.77
8 0.72
9 0.65
10 0.6
11 0.53
12 0.44
13 0.41
14 0.36
15 0.43
16 0.38
17 0.39
18 0.37
19 0.4
20 0.47
21 0.44
22 0.4
23 0.37
24 0.4
25 0.43
26 0.43
27 0.39
28 0.34
29 0.33
30 0.33
31 0.29
32 0.29
33 0.28
34 0.27
35 0.27
36 0.24
37 0.23
38 0.22
39 0.21
40 0.22
41 0.23
42 0.27
43 0.31
44 0.33
45 0.34
46 0.35
47 0.36
48 0.31
49 0.25
50 0.21
51 0.16
52 0.14
53 0.13
54 0.13
55 0.1
56 0.1
57 0.1
58 0.09
59 0.09
60 0.08
61 0.08
62 0.06
63 0.06
64 0.05
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.08
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.07
81 0.07
82 0.06
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.09
91 0.09
92 0.11
93 0.13
94 0.13
95 0.14
96 0.14
97 0.14
98 0.14
99 0.15
100 0.13
101 0.13
102 0.13
103 0.13
104 0.12
105 0.11
106 0.1
107 0.09
108 0.09
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.1
116 0.1
117 0.17
118 0.21
119 0.26
120 0.29
121 0.31
122 0.32
123 0.3
124 0.33
125 0.32