Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40166

Protein Details
Accession P40166   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
66-92LTPRLNGKTTKKPKRNLRTQRVFDEKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MSFNGISIRVITSYFLFFLDNLSKIKFSRLFSFKYRDFCDSCPLDIIIINASIRCLRSVFDFLHILTPRLNGKTTKKPKRNLRTQRVFDEKLHSHNASPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.1
5 0.13
6 0.15
7 0.15
8 0.15
9 0.16
10 0.17
11 0.17
12 0.23
13 0.24
14 0.24
15 0.31
16 0.33
17 0.36
18 0.4
19 0.47
20 0.45
21 0.46
22 0.46
23 0.42
24 0.41
25 0.38
26 0.4
27 0.35
28 0.31
29 0.26
30 0.23
31 0.19
32 0.16
33 0.15
34 0.08
35 0.07
36 0.07
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.09
45 0.12
46 0.12
47 0.14
48 0.15
49 0.15
50 0.21
51 0.21
52 0.19
53 0.17
54 0.19
55 0.19
56 0.19
57 0.21
58 0.2
59 0.26
60 0.37
61 0.47
62 0.56
63 0.62
64 0.7
65 0.79
66 0.85
67 0.89
68 0.9
69 0.9
70 0.9
71 0.88
72 0.88
73 0.86
74 0.79
75 0.7
76 0.68
77 0.6
78 0.55
79 0.55
80 0.47