Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P48164

Protein Details
Accession P48164    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-119LPKPSRTSRQVQKRPRSRTLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.833, mito_nucl 11.665, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042274  P:ribosomal small subunit biogenesis  
GO:0042254  P:ribosome biogenesis  
GO:0006364  P:rRNA processing  
KEGG sce:YNL096C  -  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSSVQSKILSQAPSELELQVAKTFIDLESSSPELKADLRPLQIKSIREIDVTGGKKALVLFVPVPALSAYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPSRTSRQVQKRPRSRTLTAVHDKVLEDMVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPSQTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.18
4 0.17
5 0.18
6 0.14
7 0.13
8 0.1
9 0.09
10 0.1
11 0.09
12 0.12
13 0.1
14 0.11
15 0.15
16 0.17
17 0.17
18 0.16
19 0.17
20 0.14
21 0.15
22 0.17
23 0.18
24 0.21
25 0.25
26 0.29
27 0.3
28 0.37
29 0.4
30 0.38
31 0.36
32 0.37
33 0.34
34 0.3
35 0.29
36 0.24
37 0.27
38 0.27
39 0.24
40 0.19
41 0.18
42 0.18
43 0.18
44 0.17
45 0.09
46 0.1
47 0.1
48 0.1
49 0.11
50 0.1
51 0.1
52 0.08
53 0.09
54 0.08
55 0.11
56 0.11
57 0.15
58 0.17
59 0.18
60 0.22
61 0.27
62 0.31
63 0.35
64 0.39
65 0.42
66 0.44
67 0.47
68 0.51
69 0.51
70 0.52
71 0.48
72 0.47
73 0.47
74 0.45
75 0.43
76 0.38
77 0.34
78 0.29
79 0.3
80 0.29
81 0.21
82 0.21
83 0.2
84 0.2
85 0.2
86 0.21
87 0.24
88 0.3
89 0.35
90 0.41
91 0.43
92 0.49
93 0.56
94 0.65
95 0.68
96 0.7
97 0.74
98 0.77
99 0.81
100 0.82
101 0.8
102 0.71
103 0.69
104 0.64
105 0.64
106 0.6
107 0.54
108 0.46
109 0.4
110 0.38
111 0.3
112 0.26
113 0.16
114 0.1
115 0.09
116 0.09
117 0.08
118 0.08
119 0.07
120 0.1
121 0.11
122 0.13
123 0.16
124 0.15
125 0.17
126 0.18
127 0.18
128 0.15
129 0.19
130 0.24
131 0.3
132 0.36
133 0.38
134 0.39
135 0.39
136 0.38
137 0.35
138 0.31
139 0.28
140 0.24
141 0.27
142 0.25
143 0.28
144 0.35
145 0.35
146 0.31
147 0.3
148 0.29
149 0.27
150 0.28
151 0.25
152 0.19
153 0.2
154 0.2
155 0.16
156 0.19
157 0.2
158 0.2
159 0.2
160 0.23
161 0.25
162 0.26
163 0.29
164 0.28
165 0.23
166 0.23
167 0.24
168 0.25
169 0.25
170 0.25