Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7THT1

Protein Details
Accession A0A0F7THT1    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-43CRRKDASSARIKRNRKNQQTKFKVRCERFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.5, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVSDIKQFIEICRRKDASSARIKRNRKNQQTKFKVRCERFVYTLALTDSAKAEKLKQSLPPSLKVVDVAKGDKKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.43
4 0.39
5 0.45
6 0.48
7 0.47
8 0.52
9 0.57
10 0.6
11 0.67
12 0.73
13 0.75
14 0.8
15 0.81
16 0.81
17 0.84
18 0.84
19 0.86
20 0.89
21 0.91
22 0.88
23 0.86
24 0.85
25 0.76
26 0.74
27 0.68
28 0.61
29 0.53
30 0.48
31 0.41
32 0.31
33 0.31
34 0.24
35 0.19
36 0.16
37 0.14
38 0.12
39 0.1
40 0.12
41 0.11
42 0.13
43 0.16
44 0.2
45 0.22
46 0.28
47 0.33
48 0.4
49 0.42
50 0.44
51 0.42
52 0.41
53 0.38
54 0.34
55 0.3
56 0.27
57 0.27
58 0.28
59 0.33