Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q08981

Protein Details
Accession Q08981    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21ISPSKKRTILSSKNINQKPRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0055105  F:ubiquitin-protein transferase inhibitor activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0031397  P:negative regulation of protein ubiquitination  
KEGG sce:YPL267W  -  
Amino Acid Sequences MISPSKKRTILSSKNINQKPRAVVKGNELRSPSKRRSQIDTDYALRRSPIKTIQISKAAQFMLYEETAEERNIAVHRHNEIYNNNNSVSNENNPSQVKENLSPAKICPYERAFLREGGRIALKDLSVDEFKGYIQDPLTDETIPLTLPLGDKKISLPSFITPPRNSKISIFFTSKHQGQNPETKISRSTDDVSEKKVVRKLSFHVYEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.78
4 0.72
5 0.69
6 0.67
7 0.65
8 0.64
9 0.59
10 0.55
11 0.58
12 0.63
13 0.6
14 0.56
15 0.51
16 0.5
17 0.52
18 0.58
19 0.54
20 0.54
21 0.59
22 0.59
23 0.63
24 0.65
25 0.65
26 0.64
27 0.63
28 0.59
29 0.55
30 0.52
31 0.45
32 0.39
33 0.33
34 0.28
35 0.26
36 0.27
37 0.29
38 0.34
39 0.39
40 0.43
41 0.47
42 0.47
43 0.44
44 0.41
45 0.34
46 0.28
47 0.22
48 0.18
49 0.14
50 0.13
51 0.12
52 0.09
53 0.1
54 0.11
55 0.11
56 0.1
57 0.06
58 0.08
59 0.09
60 0.1
61 0.11
62 0.13
63 0.16
64 0.18
65 0.19
66 0.21
67 0.23
68 0.26
69 0.28
70 0.27
71 0.26
72 0.24
73 0.24
74 0.22
75 0.21
76 0.19
77 0.19
78 0.18
79 0.21
80 0.2
81 0.21
82 0.23
83 0.22
84 0.22
85 0.2
86 0.25
87 0.24
88 0.24
89 0.23
90 0.2
91 0.24
92 0.23
93 0.22
94 0.21
95 0.2
96 0.22
97 0.22
98 0.26
99 0.22
100 0.24
101 0.26
102 0.24
103 0.21
104 0.2
105 0.2
106 0.16
107 0.16
108 0.13
109 0.11
110 0.09
111 0.09
112 0.1
113 0.09
114 0.1
115 0.09
116 0.08
117 0.08
118 0.09
119 0.09
120 0.08
121 0.08
122 0.09
123 0.1
124 0.12
125 0.14
126 0.12
127 0.12
128 0.11
129 0.11
130 0.09
131 0.08
132 0.06
133 0.06
134 0.07
135 0.08
136 0.1
137 0.1
138 0.11
139 0.12
140 0.19
141 0.19
142 0.2
143 0.2
144 0.2
145 0.27
146 0.32
147 0.38
148 0.33
149 0.38
150 0.41
151 0.41
152 0.4
153 0.37
154 0.39
155 0.39
156 0.41
157 0.39
158 0.36
159 0.41
160 0.46
161 0.47
162 0.45
163 0.43
164 0.45
165 0.46
166 0.55
167 0.53
168 0.54
169 0.52
170 0.48
171 0.47
172 0.43
173 0.41
174 0.35
175 0.35
176 0.33
177 0.4
178 0.41
179 0.42
180 0.47
181 0.46
182 0.48
183 0.49
184 0.49
185 0.44
186 0.47
187 0.47
188 0.5
189 0.53