Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53758

Protein Details
Accession P53758    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-84FNIPTKSPPKSPKHKNYLSFNFTKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 7.5, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007414  DUF468  
KEGG sce:YNR077C  -  
Pfam View protein in Pfam  
PF04318  DUF468  
Amino Acid Sequences MHGTCLSGLYPEPFTHNSHDYPHFNIYISFGGPKYCITALNTYVIPLLHHILTTQFIHTYFNIPTKSPPKSPKHKNYLSFNFTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.28
4 0.27
5 0.3
6 0.35
7 0.33
8 0.35
9 0.35
10 0.3
11 0.27
12 0.26
13 0.23
14 0.18
15 0.16
16 0.14
17 0.11
18 0.11
19 0.11
20 0.11
21 0.1
22 0.1
23 0.1
24 0.11
25 0.13
26 0.14
27 0.15
28 0.15
29 0.13
30 0.13
31 0.12
32 0.1
33 0.08
34 0.09
35 0.07
36 0.07
37 0.07
38 0.07
39 0.09
40 0.1
41 0.1
42 0.09
43 0.09
44 0.11
45 0.12
46 0.14
47 0.13
48 0.18
49 0.19
50 0.19
51 0.25
52 0.3
53 0.35
54 0.4
55 0.48
56 0.53
57 0.62
58 0.72
59 0.76
60 0.8
61 0.84
62 0.84
63 0.85
64 0.86