Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P51996

Protein Details
Accession P51996    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
203-222TISLTPAPKEDKKKKSSNCCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.833, nucl 13, cyto 12.5, cyto_mito 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
Gene Ontology GO:0005935  C:cellular bud neck  
GO:0005829  C:cytosol  
GO:0005768  C:endosome  
GO:0005794  C:Golgi apparatus  
GO:0000139  C:Golgi membrane  
GO:0005741  C:mitochondrial outer membrane  
GO:0055037  C:recycling endosome  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0006914  P:autophagy  
GO:0034498  P:early endosome to Golgi transport  
GO:0006887  P:exocytosis  
GO:0015031  P:protein transport  
GO:0016192  P:vesicle-mediated transport  
KEGG sce:YGL210W  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
CDD cd01868  Rab11_like  
Amino Acid Sequences MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.1
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.11
11 0.1
12 0.1
13 0.09
14 0.15
15 0.17
16 0.19
17 0.19
18 0.2
19 0.25
20 0.27
21 0.29
22 0.24
23 0.23
24 0.23
25 0.24
26 0.23
27 0.18
28 0.17
29 0.14
30 0.15
31 0.13
32 0.1
33 0.09
34 0.08
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.11
42 0.15
43 0.15
44 0.21
45 0.27
46 0.27
47 0.29
48 0.31
49 0.32
50 0.34
51 0.35
52 0.33
53 0.32
54 0.34
55 0.34
56 0.36
57 0.37
58 0.3
59 0.27
60 0.22
61 0.2
62 0.17
63 0.16
64 0.12
65 0.14
66 0.16
67 0.2
68 0.2
69 0.19
70 0.18
71 0.17
72 0.17
73 0.11
74 0.09
75 0.05
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.05
85 0.07
86 0.1
87 0.14
88 0.18
89 0.2
90 0.24
91 0.24
92 0.24
93 0.22
94 0.24
95 0.24
96 0.26
97 0.25
98 0.22
99 0.22
100 0.22
101 0.22
102 0.18
103 0.15
104 0.08
105 0.07
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.07
117 0.08
118 0.09
119 0.1
120 0.11
121 0.12
122 0.13
123 0.13
124 0.14
125 0.14
126 0.13
127 0.16
128 0.15
129 0.15
130 0.14
131 0.14
132 0.14
133 0.12
134 0.12
135 0.09
136 0.09
137 0.09
138 0.09
139 0.09
140 0.08
141 0.08
142 0.09
143 0.09
144 0.1
145 0.09
146 0.1
147 0.11
148 0.11
149 0.12
150 0.12
151 0.11
152 0.12
153 0.13
154 0.12
155 0.12
156 0.1
157 0.1
158 0.11
159 0.11
160 0.09
161 0.08
162 0.09
163 0.08
164 0.09
165 0.12
166 0.11
167 0.11
168 0.11
169 0.13
170 0.14
171 0.15
172 0.17
173 0.18
174 0.17
175 0.17
176 0.17
177 0.16
178 0.16
179 0.14
180 0.12
181 0.08
182 0.1
183 0.11
184 0.12
185 0.12
186 0.12
187 0.15
188 0.15
189 0.16
190 0.17
191 0.21
192 0.26
193 0.3
194 0.33
195 0.35
196 0.42
197 0.48
198 0.56
199 0.61
200 0.64
201 0.69
202 0.76