Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P40464

Protein Details
Accession P40464    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
202-224AVYDTLKQRKLRRKRENGLDIHLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto_nucl 7.5, cyto 6.5, nucl 5.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002067  Mit_carrier  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
IPR044712  SLC25A32-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005739  C:mitochondrion  
GO:0015230  F:FAD transmembrane transporter activity  
GO:0008517  F:folic acid transmembrane transporter activity  
GO:0015883  P:FAD transport  
GO:1904947  P:folate import into mitochondrion  
KEGG sce:YIL134W  -  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MVDHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYENLKHRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.15
4 0.13
5 0.13
6 0.1
7 0.08
8 0.06
9 0.05
10 0.07
11 0.07
12 0.07
13 0.07
14 0.08
15 0.08
16 0.09
17 0.11
18 0.11
19 0.13
20 0.14
21 0.19
22 0.2
23 0.21
24 0.21
25 0.2
26 0.22
27 0.28
28 0.28
29 0.26
30 0.26
31 0.25
32 0.28
33 0.28
34 0.25
35 0.2
36 0.2
37 0.17
38 0.23
39 0.23
40 0.21
41 0.22
42 0.21
43 0.21
44 0.2
45 0.21
46 0.16
47 0.16
48 0.2
49 0.24
50 0.26
51 0.24
52 0.25
53 0.25
54 0.26
55 0.29
56 0.26
57 0.24
58 0.23
59 0.23
60 0.22
61 0.21
62 0.2
63 0.16
64 0.15
65 0.12
66 0.11
67 0.11
68 0.09
69 0.09
70 0.08
71 0.07
72 0.07
73 0.06
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.07
87 0.08
88 0.08
89 0.1
90 0.14
91 0.14
92 0.21
93 0.22
94 0.22
95 0.24
96 0.28
97 0.36
98 0.32
99 0.31
100 0.27
101 0.3
102 0.29
103 0.29
104 0.29
105 0.24
106 0.26
107 0.26
108 0.24
109 0.21
110 0.21
111 0.19
112 0.14
113 0.1
114 0.07
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.08
136 0.09
137 0.11
138 0.12
139 0.16
140 0.18
141 0.18
142 0.2
143 0.23
144 0.22
145 0.21
146 0.2
147 0.17
148 0.15
149 0.15
150 0.14
151 0.09
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.09
167 0.11
168 0.11
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.08
175 0.06
176 0.06
177 0.07
178 0.06
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.06
190 0.06
191 0.07
192 0.11
193 0.17
194 0.22
195 0.27
196 0.36
197 0.45
198 0.56
199 0.66
200 0.72
201 0.78
202 0.83
203 0.88
204 0.89
205 0.82
206 0.77
207 0.72
208 0.61
209 0.51
210 0.43
211 0.32
212 0.23
213 0.19
214 0.13
215 0.07
216 0.07
217 0.06
218 0.05
219 0.05
220 0.05
221 0.06
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.06
229 0.07
230 0.08
231 0.08
232 0.09
233 0.08
234 0.09
235 0.15
236 0.16
237 0.19
238 0.26
239 0.33
240 0.34
241 0.38
242 0.41
243 0.38
244 0.45
245 0.5
246 0.44
247 0.42
248 0.46
249 0.49
250 0.47
251 0.49
252 0.49
253 0.4
254 0.39
255 0.44
256 0.41
257 0.35
258 0.34
259 0.3
260 0.27
261 0.26
262 0.25
263 0.16
264 0.12
265 0.11
266 0.11
267 0.12
268 0.06
269 0.06
270 0.06
271 0.07
272 0.07
273 0.09
274 0.09
275 0.1
276 0.13
277 0.14
278 0.14
279 0.15
280 0.16
281 0.17
282 0.18
283 0.19
284 0.16
285 0.18
286 0.2
287 0.2
288 0.19
289 0.26
290 0.27
291 0.31