Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7VDQ8

Protein Details
Accession A0A0F7VDQ8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
178-201EKEAEEKKKKTNKEEKKLTGRELWBasic
NLS Segment(s)
PositionSequence
182-194EEKKKKTNKEEKK
Subcellular Location(s) cyto 12.5cyto_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040213  GIR2-like  
IPR006575  RWD-domain  
IPR016135  UBQ-conjugating_enzyme/RWD  
Pfam View protein in Pfam  
PF05773  RWD  
PROSITE View protein in PROSITE  
PS50908  RWD  
Amino Acid Sequences MGREDQIEEREVLDSIFPDEITDISETSYKISITLDPPENGPETEQPVIYLEVSYPEDYPDVAPELKITPVPNAPKHPLIELPEDEDVLTSALNNAIEENMGMAMVFSLVSALKEAAEQLMVDRVQAVEEEKALVAQKAEEEENRKFRGTPVNRETFQKWLDDFKKEADEEEQRQREEKEAEEKKKKTNKEEKKLTGRELWERGLAGKADYDEEEEDAMPAVDKLKVTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.1
5 0.09
6 0.09
7 0.09
8 0.1
9 0.11
10 0.09
11 0.09
12 0.12
13 0.11
14 0.13
15 0.14
16 0.12
17 0.12
18 0.13
19 0.15
20 0.16
21 0.22
22 0.24
23 0.23
24 0.25
25 0.26
26 0.27
27 0.24
28 0.23
29 0.19
30 0.2
31 0.21
32 0.2
33 0.18
34 0.17
35 0.18
36 0.16
37 0.13
38 0.09
39 0.1
40 0.12
41 0.13
42 0.11
43 0.11
44 0.11
45 0.12
46 0.12
47 0.1
48 0.11
49 0.1
50 0.1
51 0.1
52 0.11
53 0.11
54 0.13
55 0.12
56 0.12
57 0.17
58 0.22
59 0.25
60 0.29
61 0.32
62 0.34
63 0.34
64 0.33
65 0.31
66 0.29
67 0.3
68 0.25
69 0.24
70 0.21
71 0.2
72 0.19
73 0.16
74 0.12
75 0.08
76 0.07
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.03
106 0.03
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.05
116 0.05
117 0.06
118 0.05
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.06
125 0.07
126 0.08
127 0.1
128 0.14
129 0.19
130 0.24
131 0.26
132 0.26
133 0.25
134 0.27
135 0.35
136 0.36
137 0.41
138 0.44
139 0.49
140 0.49
141 0.53
142 0.52
143 0.47
144 0.42
145 0.35
146 0.29
147 0.31
148 0.33
149 0.33
150 0.33
151 0.3
152 0.33
153 0.31
154 0.31
155 0.27
156 0.3
157 0.32
158 0.41
159 0.42
160 0.38
161 0.41
162 0.4
163 0.4
164 0.36
165 0.34
166 0.34
167 0.4
168 0.49
169 0.56
170 0.59
171 0.64
172 0.7
173 0.73
174 0.74
175 0.75
176 0.77
177 0.78
178 0.85
179 0.85
180 0.88
181 0.86
182 0.8
183 0.76
184 0.7
185 0.67
186 0.61
187 0.53
188 0.45
189 0.39
190 0.36
191 0.32
192 0.27
193 0.2
194 0.18
195 0.16
196 0.16
197 0.16
198 0.18
199 0.15
200 0.15
201 0.16
202 0.14
203 0.13
204 0.12
205 0.11
206 0.09
207 0.08
208 0.09
209 0.09