Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P32342

Protein Details
Accession P32342    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-107EKIAQSKKKNNKIKESSKKIKGKSHydrophilic
145-167QNNNGNSAASKKKKNKNKGKKKRHydrophilic
NLS Segment(s)
PositionSequence
85-106KIAQSKKKNNKIKESSKKIKGK
154-167SKKKKNKNKGKKKR
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0003723  F:RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
GO:0006617  P:SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition  
KEGG sce:YKL122C  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNKSKDVSRLLSALGPRGVSITPGKIEKIAQSKKKNNKIKESSKKIKGKSIQDIVGLATLIVNTDVEKSDPAAKKTATEPKQKANAVQNNNGNSAASKKKKNKNKGKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.21
4 0.19
5 0.24
6 0.24
7 0.25
8 0.25
9 0.25
10 0.24
11 0.26
12 0.23
13 0.18
14 0.21
15 0.21
16 0.26
17 0.29
18 0.33
19 0.35
20 0.39
21 0.43
22 0.45
23 0.49
24 0.53
25 0.55
26 0.57
27 0.58
28 0.56
29 0.56
30 0.54
31 0.54
32 0.48
33 0.48
34 0.44
35 0.42
36 0.41
37 0.39
38 0.36
39 0.34
40 0.3
41 0.26
42 0.25
43 0.25
44 0.32
45 0.3
46 0.34
47 0.35
48 0.38
49 0.39
50 0.43
51 0.43
52 0.34
53 0.32
54 0.26
55 0.24
56 0.21
57 0.2
58 0.15
59 0.12
60 0.1
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.11
71 0.13
72 0.21
73 0.27
74 0.34
75 0.42
76 0.51
77 0.6
78 0.7
79 0.75
80 0.72
81 0.76
82 0.77
83 0.79
84 0.81
85 0.82
86 0.81
87 0.82
88 0.83
89 0.74
90 0.73
91 0.7
92 0.66
93 0.64
94 0.6
95 0.52
96 0.45
97 0.43
98 0.35
99 0.28
100 0.21
101 0.12
102 0.07
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.06
111 0.07
112 0.08
113 0.17
114 0.2
115 0.22
116 0.26
117 0.25
118 0.27
119 0.33
120 0.42
121 0.41
122 0.47
123 0.5
124 0.54
125 0.62
126 0.62
127 0.62
128 0.62
129 0.63
130 0.6
131 0.63
132 0.61
133 0.56
134 0.56
135 0.5
136 0.4
137 0.32
138 0.32
139 0.34
140 0.35
141 0.42
142 0.5
143 0.6
144 0.7
145 0.81
146 0.86
147 0.88