Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53251

Protein Details
Accession P53251    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-107FDGISKSSIRRRKRKLREELKPRMQDLHydrophilic
NLS Segment(s)
PositionSequence
89-99IRRRKRKLREE
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0032040  C:small-subunit processome  
GO:0051880  F:G-quadruplex DNA binding  
GO:0030490  P:maturation of SSU-rRNA  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000056  P:ribosomal small subunit export from nucleus  
KEGG sce:YGR081C  -  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MVAKKRNTLRSKVSARNSQNFGPDVANNGILDESYDIESDPRAFLHQPKETKKEKLLNRQNTFLSNLKGKSTLNDGIAANFDGISKSSIRRRKRKLREELKPRMQDLLTSLEQEKDLRGIIENSSKDMNNDDDIDMDSKIRFVDTKEMNLKKIEPGSVRIKKNQPNIRNQKGAKALAANETARFNQVLTNQDFQKNPFGALREVIKLQKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.74
5 0.67
6 0.62
7 0.54
8 0.48
9 0.4
10 0.33
11 0.29
12 0.26
13 0.24
14 0.19
15 0.18
16 0.16
17 0.13
18 0.13
19 0.09
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.1
26 0.1
27 0.09
28 0.08
29 0.1
30 0.12
31 0.17
32 0.25
33 0.31
34 0.38
35 0.44
36 0.52
37 0.55
38 0.59
39 0.61
40 0.62
41 0.64
42 0.67
43 0.71
44 0.74
45 0.72
46 0.71
47 0.64
48 0.58
49 0.54
50 0.46
51 0.38
52 0.33
53 0.3
54 0.26
55 0.27
56 0.24
57 0.22
58 0.24
59 0.23
60 0.19
61 0.21
62 0.2
63 0.18
64 0.19
65 0.18
66 0.12
67 0.09
68 0.08
69 0.06
70 0.06
71 0.07
72 0.07
73 0.1
74 0.18
75 0.26
76 0.35
77 0.44
78 0.54
79 0.64
80 0.74
81 0.81
82 0.85
83 0.87
84 0.88
85 0.89
86 0.89
87 0.87
88 0.8
89 0.7
90 0.62
91 0.51
92 0.41
93 0.33
94 0.28
95 0.19
96 0.17
97 0.16
98 0.14
99 0.15
100 0.14
101 0.13
102 0.08
103 0.08
104 0.06
105 0.07
106 0.07
107 0.09
108 0.14
109 0.14
110 0.15
111 0.16
112 0.16
113 0.15
114 0.16
115 0.16
116 0.12
117 0.14
118 0.12
119 0.11
120 0.12
121 0.13
122 0.11
123 0.1
124 0.09
125 0.08
126 0.08
127 0.07
128 0.07
129 0.08
130 0.16
131 0.17
132 0.24
133 0.33
134 0.35
135 0.36
136 0.37
137 0.37
138 0.32
139 0.33
140 0.3
141 0.23
142 0.27
143 0.35
144 0.42
145 0.45
146 0.49
147 0.55
148 0.58
149 0.67
150 0.71
151 0.68
152 0.71
153 0.78
154 0.78
155 0.79
156 0.72
157 0.7
158 0.67
159 0.61
160 0.52
161 0.45
162 0.38
163 0.33
164 0.37
165 0.3
166 0.25
167 0.26
168 0.24
169 0.22
170 0.21
171 0.17
172 0.17
173 0.2
174 0.25
175 0.26
176 0.32
177 0.33
178 0.38
179 0.39
180 0.38
181 0.43
182 0.36
183 0.34
184 0.32
185 0.32
186 0.29
187 0.31
188 0.32
189 0.27
190 0.3