Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7TZQ3

Protein Details
Accession A0A0F7TZQ3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
149-171HDIASERPRRRKPWEKDVEEPASBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MAESQSPSSFEQLKAYSFTSDPEFANGLAIILGHAGTPASEAEMSRDDDLVLQAKCFFFSRKEKITPPLNFTAYKAWLAGKSSESNPATAIPEQSNESSTESAAVATTESSALPEPAYPTSFAHIVELITTGKPVPGIQQIPDTVLEGHDIASERPRRRKPWEKDVEEPASLQGEMASNAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.25
4 0.22
5 0.23
6 0.22
7 0.23
8 0.21
9 0.21
10 0.21
11 0.18
12 0.19
13 0.16
14 0.12
15 0.09
16 0.09
17 0.06
18 0.05
19 0.05
20 0.03
21 0.04
22 0.03
23 0.03
24 0.04
25 0.04
26 0.05
27 0.06
28 0.06
29 0.09
30 0.11
31 0.13
32 0.13
33 0.13
34 0.12
35 0.12
36 0.13
37 0.15
38 0.13
39 0.11
40 0.13
41 0.12
42 0.14
43 0.14
44 0.15
45 0.16
46 0.25
47 0.31
48 0.36
49 0.4
50 0.42
51 0.48
52 0.55
53 0.53
54 0.5
55 0.48
56 0.44
57 0.4
58 0.39
59 0.35
60 0.27
61 0.25
62 0.19
63 0.15
64 0.14
65 0.15
66 0.15
67 0.13
68 0.14
69 0.14
70 0.21
71 0.2
72 0.19
73 0.18
74 0.18
75 0.18
76 0.16
77 0.17
78 0.1
79 0.11
80 0.12
81 0.12
82 0.12
83 0.11
84 0.12
85 0.11
86 0.1
87 0.1
88 0.08
89 0.08
90 0.07
91 0.06
92 0.04
93 0.04
94 0.05
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.07
103 0.08
104 0.1
105 0.1
106 0.1
107 0.12
108 0.13
109 0.12
110 0.12
111 0.11
112 0.1
113 0.09
114 0.1
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.07
122 0.09
123 0.14
124 0.16
125 0.17
126 0.2
127 0.21
128 0.22
129 0.22
130 0.2
131 0.14
132 0.13
133 0.13
134 0.1
135 0.09
136 0.1
137 0.1
138 0.1
139 0.18
140 0.25
141 0.31
142 0.41
143 0.49
144 0.55
145 0.64
146 0.74
147 0.76
148 0.79
149 0.83
150 0.81
151 0.8
152 0.82
153 0.77
154 0.67
155 0.58
156 0.49
157 0.4
158 0.32
159 0.25
160 0.16
161 0.12