Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7TMP6

Protein Details
Accession A0A0F7TMP6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
163-188LDLRIFKVIKEKQKKEKEEAERAKAEHydrophilic
NLS Segment(s)
PositionSequence
172-187KEKQKKEKEEAERAKA
Subcellular Location(s) nucl 11cyto 11cyto_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR023389  DOPA-like_sf  
IPR014980  DOPA_dioxygen  
Pfam View protein in Pfam  
PF08883  DOPA_dioxygen  
Amino Acid Sequences MTDQFAFSYPSPLEGYENLEPLSDERNDDGKSIKNPQHGILSKAYEEFPDPLAKDRRGGFDIHIYHFQTNPDQVAFAKALYERIRREFPELRIYTFFDRPIGPHPVAMFEVNLFTPAQFGAFIPWLVINRGPLSALVHPNTVDEEEERNHTQRATWLGDRIPLDLRIFKVIKEKQKKEKEEAERAKAEGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.22
4 0.23
5 0.21
6 0.2
7 0.19
8 0.18
9 0.21
10 0.15
11 0.15
12 0.16
13 0.2
14 0.2
15 0.21
16 0.22
17 0.24
18 0.27
19 0.34
20 0.37
21 0.39
22 0.4
23 0.41
24 0.48
25 0.45
26 0.44
27 0.4
28 0.37
29 0.32
30 0.31
31 0.29
32 0.2
33 0.2
34 0.18
35 0.15
36 0.16
37 0.16
38 0.21
39 0.27
40 0.27
41 0.29
42 0.3
43 0.32
44 0.3
45 0.31
46 0.26
47 0.27
48 0.29
49 0.28
50 0.3
51 0.27
52 0.27
53 0.26
54 0.26
55 0.2
56 0.18
57 0.17
58 0.13
59 0.12
60 0.11
61 0.12
62 0.11
63 0.09
64 0.09
65 0.08
66 0.12
67 0.15
68 0.19
69 0.19
70 0.23
71 0.26
72 0.26
73 0.32
74 0.33
75 0.32
76 0.38
77 0.37
78 0.35
79 0.34
80 0.35
81 0.32
82 0.28
83 0.25
84 0.17
85 0.16
86 0.15
87 0.17
88 0.2
89 0.17
90 0.17
91 0.16
92 0.17
93 0.17
94 0.16
95 0.12
96 0.08
97 0.08
98 0.07
99 0.08
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.11
121 0.14
122 0.17
123 0.17
124 0.17
125 0.17
126 0.18
127 0.18
128 0.16
129 0.13
130 0.11
131 0.13
132 0.13
133 0.19
134 0.21
135 0.22
136 0.22
137 0.21
138 0.21
139 0.22
140 0.26
141 0.26
142 0.26
143 0.27
144 0.27
145 0.32
146 0.31
147 0.29
148 0.27
149 0.23
150 0.24
151 0.24
152 0.24
153 0.27
154 0.27
155 0.26
156 0.34
157 0.38
158 0.47
159 0.55
160 0.62
161 0.66
162 0.76
163 0.81
164 0.8
165 0.83
166 0.82
167 0.82
168 0.83
169 0.8
170 0.73
171 0.68