Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q08213

Protein Details
Accession Q08213    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
101-120SKFISKTPPKYWKKPVKDMDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, mito_nucl 12, nucl 4, cyto 3.5, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0004519  F:endonuclease activity  
GO:0004535  F:poly(A)-specific ribonuclease activity  
KEGG sce:YOL042W  -  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
Amino Acid Sequences MFTRRFIPVVQSTKQNIGKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLNTHLYWKYDEVKLTQCMIIMRELSKIIKQLLPGDVKGQERVKILFTGDLNSTRDSLVVNFLQGQIVSHGDLNLINPMRPYLDRCVYDDIPKDYFVHTCYSGKLKGIFDYVWYHDSDFLLTKILTGNEVSDELLASNQLGLPNENHPSDHIPLLTEFKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.5
4 0.52
5 0.56
6 0.55
7 0.62
8 0.62
9 0.6
10 0.62
11 0.59
12 0.6
13 0.54
14 0.5
15 0.47
16 0.43
17 0.41
18 0.39
19 0.37
20 0.29
21 0.27
22 0.25
23 0.18
24 0.18
25 0.21
26 0.22
27 0.2
28 0.2
29 0.22
30 0.24
31 0.24
32 0.21
33 0.18
34 0.22
35 0.24
36 0.24
37 0.22
38 0.27
39 0.34
40 0.37
41 0.38
42 0.38
43 0.46
44 0.53
45 0.63
46 0.62
47 0.58
48 0.59
49 0.66
50 0.61
51 0.58
52 0.53
53 0.46
54 0.4
55 0.37
56 0.31
57 0.25
58 0.22
59 0.17
60 0.15
61 0.17
62 0.17
63 0.17
64 0.16
65 0.15
66 0.16
67 0.19
68 0.18
69 0.14
70 0.14
71 0.14
72 0.16
73 0.16
74 0.19
75 0.16
76 0.15
77 0.15
78 0.14
79 0.14
80 0.16
81 0.12
82 0.09
83 0.08
84 0.1
85 0.1
86 0.1
87 0.09
88 0.08
89 0.09
90 0.11
91 0.21
92 0.27
93 0.33
94 0.42
95 0.53
96 0.58
97 0.66
98 0.75
99 0.75
100 0.77
101 0.81
102 0.8
103 0.77
104 0.76
105 0.69
106 0.65
107 0.56
108 0.49
109 0.39
110 0.32
111 0.23
112 0.17
113 0.16
114 0.09
115 0.07
116 0.07
117 0.06
118 0.06
119 0.07
120 0.08
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.09
128 0.09
129 0.08
130 0.09
131 0.08
132 0.09
133 0.13
134 0.13
135 0.14
136 0.18
137 0.17
138 0.19
139 0.21
140 0.23
141 0.28
142 0.36
143 0.39
144 0.41
145 0.41
146 0.4
147 0.41
148 0.39
149 0.33
150 0.28
151 0.24
152 0.19
153 0.19
154 0.18
155 0.14
156 0.13
157 0.1
158 0.07
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.07
168 0.1
169 0.1
170 0.14
171 0.14
172 0.16
173 0.16
174 0.2
175 0.19
176 0.22
177 0.27
178 0.26
179 0.27
180 0.27
181 0.26
182 0.24
183 0.23
184 0.22
185 0.18
186 0.17
187 0.15
188 0.14
189 0.15
190 0.13
191 0.13
192 0.08
193 0.09
194 0.08
195 0.09
196 0.09
197 0.11
198 0.14
199 0.16
200 0.17
201 0.17
202 0.21
203 0.22
204 0.22
205 0.2
206 0.18
207 0.17
208 0.16
209 0.16
210 0.13
211 0.12
212 0.11
213 0.12
214 0.12
215 0.13
216 0.14
217 0.15
218 0.15
219 0.15
220 0.17
221 0.21
222 0.22
223 0.21
224 0.22
225 0.24
226 0.23
227 0.27
228 0.26
229 0.23
230 0.23
231 0.24
232 0.23
233 0.2
234 0.2
235 0.18
236 0.17
237 0.17
238 0.17
239 0.19
240 0.19
241 0.19
242 0.19
243 0.15
244 0.15
245 0.13
246 0.12
247 0.13
248 0.11
249 0.11
250 0.11
251 0.12
252 0.12
253 0.11
254 0.11
255 0.08
256 0.09
257 0.09
258 0.08
259 0.08
260 0.08
261 0.09
262 0.09
263 0.13
264 0.13
265 0.13
266 0.13
267 0.13
268 0.15
269 0.16
270 0.19
271 0.21
272 0.27
273 0.28
274 0.31
275 0.38
276 0.37
277 0.41
278 0.43
279 0.39
280 0.34
281 0.34
282 0.32
283 0.26
284 0.26
285 0.22
286 0.21
287 0.21
288 0.2
289 0.22
290 0.25
291 0.26
292 0.27
293 0.31
294 0.28
295 0.27
296 0.29
297 0.26
298 0.24
299 0.27
300 0.27
301 0.24
302 0.24
303 0.22
304 0.21
305 0.21
306 0.2
307 0.17
308 0.14
309 0.15
310 0.14
311 0.14
312 0.15
313 0.15
314 0.14
315 0.13
316 0.13
317 0.12
318 0.13
319 0.13
320 0.1
321 0.1
322 0.09
323 0.09
324 0.08
325 0.07
326 0.07
327 0.08
328 0.1
329 0.11
330 0.12
331 0.14
332 0.19
333 0.23
334 0.24
335 0.23
336 0.24
337 0.28
338 0.29
339 0.3
340 0.26
341 0.23
342 0.24
343 0.29