Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q08213

Protein Details
Accession Q08213   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
101-120SKFISKTPPKYWKKPVKDMDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, mito_nucl 12, nucl 4, cyto 3.5, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0004519  F:endonuclease activity  
GO:0004535  F:poly(A)-specific ribonuclease activity  
KEGG sce:YOL042W  -  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
Amino Acid Sequences MFTRRFIPVVQSTKQNIGKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLNTHLYWKYDEVKLTQCMIIMRELSKIIKQLLPGDVKGQERVKILFTGDLNSTRDSLVVNFLQGQIVSHGDLNLINPMRPYLDRCVYDDIPKDYFVHTCYSGKLKGIFDYVWYHDSDFLLTKILTGNEVSDELLASNQLGLPNENHPSDHIPLLTEFKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.5
4 0.52
5 0.56
6 0.55
7 0.62
8 0.62
9 0.6
10 0.62
11 0.59
12 0.6
13 0.54
14 0.5
15 0.47
16 0.43
17 0.41
18 0.39
19 0.37
20 0.29
21 0.27
22 0.25
23 0.18
24 0.18
25 0.21
26 0.22
27 0.2
28 0.2
29 0.22
30 0.24
31 0.24
32 0.21
33 0.18
34 0.22
35 0.24
36 0.24
37 0.22
38 0.27
39 0.34
40 0.37
41 0.38
42 0.38
43 0.46
44 0.53
45 0.63
46 0.62
47 0.58
48 0.59
49 0.66
50 0.61
51 0.58
52 0.53
53 0.46
54 0.4
55 0.37
56 0.31
57 0.25
58 0.22
59 0.17
60 0.15
61 0.17
62 0.17
63 0.17
64 0.16
65 0.15
66 0.16
67 0.19
68 0.18
69 0.14
70 0.14
71 0.14
72 0.16
73 0.16
74 0.19
75 0.16
76 0.15
77 0.15
78 0.14
79 0.14
80 0.16
81 0.12
82 0.09
83 0.08
84 0.1
85 0.1
86 0.1
87 0.09
88 0.08
89 0.09
90 0.11
91 0.21
92 0.27
93 0.33
94 0.42
95 0.53
96 0.58
97 0.66
98 0.75
99 0.75
100 0.77
101 0.81
102 0.8
103 0.77
104 0.76
105 0.69
106 0.65
107 0.56
108 0.49
109 0.39
110 0.32
111 0.23
112 0.17
113 0.16
114 0.09
115 0.07
116 0.07
117 0.06
118 0.06
119 0.07
120 0.08
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.09
128 0.09
129 0.08
130 0.09
131 0.08
132 0.09
133 0.13
134 0.13
135 0.14
136 0.18
137 0.17
138 0.19
139 0.21
140 0.23
141 0.28
142 0.36
143 0.39
144 0.41
145 0.41
146 0.4
147 0.41
148 0.39
149 0.33
150 0.28
151 0.24
152 0.19
153 0.19
154 0.18
155 0.14
156 0.13
157 0.1
158 0.07
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.07
168 0.1
169 0.1
170 0.14
171 0.14
172 0.16
173 0.16
174 0.2
175 0.19
176 0.22
177 0.27
178 0.26
179 0.27
180 0.27
181 0.26
182 0.24
183 0.23
184 0.22
185 0.18
186 0.17
187 0.15
188 0.14
189 0.15
190 0.13
191 0.13
192 0.08
193 0.09
194 0.08
195 0.09
196 0.09
197 0.11
198 0.14
199 0.16
200 0.17
201 0.17
202 0.21
203 0.22
204 0.22
205 0.2
206 0.18
207 0.17
208 0.16
209 0.16
210 0.13
211 0.12
212 0.11
213 0.12
214 0.12
215 0.13
216 0.14
217 0.15
218 0.15
219 0.15
220 0.17
221 0.21
222 0.22
223 0.21
224 0.22
225 0.24
226 0.23
227 0.27
228 0.26
229 0.23
230 0.23
231 0.24
232 0.23
233 0.2
234 0.2
235 0.18
236 0.17
237 0.17
238 0.17
239 0.19
240 0.19
241 0.19
242 0.19
243 0.15
244 0.15
245 0.13
246 0.12
247 0.13
248 0.11
249 0.11
250 0.11
251 0.12
252 0.12
253 0.11
254 0.11
255 0.08
256 0.09
257 0.09
258 0.08
259 0.08
260 0.08
261 0.09
262 0.09
263 0.13
264 0.13
265 0.13
266 0.13
267 0.13
268 0.15
269 0.16
270 0.19
271 0.21
272 0.27
273 0.28
274 0.31
275 0.38
276 0.37
277 0.41
278 0.43
279 0.39
280 0.34
281 0.34
282 0.32
283 0.26
284 0.26
285 0.22
286 0.21
287 0.21
288 0.2
289 0.22
290 0.25
291 0.26
292 0.27
293 0.31
294 0.28
295 0.27
296 0.29
297 0.26
298 0.24
299 0.27
300 0.27
301 0.24
302 0.24
303 0.22
304 0.21
305 0.21
306 0.2
307 0.17
308 0.14
309 0.15
310 0.14
311 0.14
312 0.15
313 0.15
314 0.14
315 0.13
316 0.13
317 0.12
318 0.13
319 0.13
320 0.1
321 0.1
322 0.09
323 0.09
324 0.08
325 0.07
326 0.07
327 0.08
328 0.1
329 0.11
330 0.12
331 0.14
332 0.19
333 0.23
334 0.24
335 0.23
336 0.24
337 0.28
338 0.29
339 0.3
340 0.26
341 0.23
342 0.24
343 0.29