Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7TKG2

Protein Details
Accession A0A0F7TKG2    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTRKGAKERVQRRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-27KTTRKGAKERVQRRKKDPNAPKR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRKGAKERVQRRKKDPNAPKRGLSAYMFFANDNRDKVREENPGITFGQVGKMLGDKWKALTETERKPYDAKAAADKKRYEEEKAKYQAQAEEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.88
4 0.87
5 0.88
6 0.88
7 0.88
8 0.88
9 0.88
10 0.88
11 0.84
12 0.77
13 0.7
14 0.63
15 0.55
16 0.46
17 0.37
18 0.3
19 0.27
20 0.25
21 0.2
22 0.19
23 0.2
24 0.2
25 0.2
26 0.18
27 0.17
28 0.19
29 0.21
30 0.25
31 0.28
32 0.28
33 0.3
34 0.29
35 0.3
36 0.28
37 0.26
38 0.21
39 0.14
40 0.13
41 0.09
42 0.08
43 0.06
44 0.06
45 0.07
46 0.09
47 0.1
48 0.09
49 0.1
50 0.12
51 0.13
52 0.13
53 0.2
54 0.24
55 0.3
56 0.38
57 0.38
58 0.38
59 0.38
60 0.39
61 0.39
62 0.37
63 0.32
64 0.34
65 0.42
66 0.47
67 0.52
68 0.53
69 0.5
70 0.53
71 0.54
72 0.51
73 0.51
74 0.52
75 0.55
76 0.6
77 0.6
78 0.54
79 0.54
80 0.51
81 0.44
82 0.42
83 0.34