Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P38061

Protein Details
Accession P38061    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MASLPHPKIVKKHTKKFKRHHSDRYHRVAENBasic
NLS Segment(s)
PositionSequence
8-36KIVKKHTKKFKRHHSDRYHRVAENWRKQK
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG sce:YBL092W  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNISQPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNISAKNRVVILARAKALGIKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.88
3 0.91
4 0.92
5 0.92
6 0.92
7 0.92
8 0.92
9 0.93
10 0.92
11 0.9
12 0.85
13 0.75
14 0.69
15 0.69
16 0.69
17 0.68
18 0.67
19 0.61
20 0.55
21 0.55
22 0.56
23 0.52
24 0.49
25 0.46
26 0.46
27 0.54
28 0.62
29 0.66
30 0.6
31 0.56
32 0.52
33 0.48
34 0.49
35 0.5
36 0.51
37 0.52
38 0.56
39 0.54
40 0.52
41 0.49
42 0.39
43 0.35
44 0.31
45 0.35
46 0.39
47 0.4
48 0.4
49 0.4
50 0.42
51 0.41
52 0.38
53 0.37
54 0.35
55 0.43
56 0.47
57 0.48
58 0.45
59 0.41
60 0.37
61 0.36
62 0.36
63 0.27
64 0.23
65 0.23
66 0.23
67 0.22
68 0.21
69 0.15
70 0.09
71 0.11
72 0.13
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.13
79 0.14
80 0.11
81 0.12
82 0.13
83 0.16
84 0.17
85 0.18
86 0.16
87 0.15
88 0.19
89 0.18
90 0.17
91 0.15
92 0.15
93 0.16
94 0.21
95 0.26
96 0.26
97 0.26
98 0.25
99 0.25
100 0.25
101 0.24
102 0.24
103 0.19
104 0.2
105 0.28
106 0.36
107 0.42
108 0.41
109 0.43
110 0.42