Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7TG73

Protein Details
Accession A0A0F7TG73    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-30PFKAMVDLIKRFRRRRRLSSELDPRWGHydrophilic
NLS Segment(s)
PositionSequence
17-18RR
271-271R
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MINPFKAMVDLIKRFRRRRRLSSELDPRWGDPSISYPNQGSWNQWDQPSGFVANASMGSPRDIQAQETRQYVALGSSPSQNPGASSDSGYQSSSAREDYSRGASAIPKGYFDENIQHRAEKSQGPAVKGLGIDGTTRRMGRTGGHTPPDDSCDDDDEEEEGRDTLGDPGGCLVFRNPLTGDPLRYSPRDDQDPYFDRASKSPPLSVTQRMRRLSQQSSSTDPTLSVAGTSSSRRTSYTAASSVSVPSLPPDTPRFAFNAGHPAHEKRSAPRPRHREPEPTARQEMVPSYDDLYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.73
3 0.79
4 0.8
5 0.84
6 0.85
7 0.85
8 0.84
9 0.86
10 0.87
11 0.82
12 0.79
13 0.7
14 0.61
15 0.55
16 0.47
17 0.37
18 0.26
19 0.26
20 0.27
21 0.27
22 0.28
23 0.26
24 0.28
25 0.33
26 0.33
27 0.3
28 0.29
29 0.34
30 0.35
31 0.36
32 0.35
33 0.3
34 0.31
35 0.3
36 0.24
37 0.17
38 0.14
39 0.13
40 0.11
41 0.11
42 0.1
43 0.09
44 0.08
45 0.11
46 0.11
47 0.12
48 0.17
49 0.17
50 0.19
51 0.25
52 0.29
53 0.31
54 0.32
55 0.32
56 0.27
57 0.27
58 0.24
59 0.17
60 0.14
61 0.12
62 0.12
63 0.15
64 0.15
65 0.16
66 0.17
67 0.16
68 0.15
69 0.16
70 0.18
71 0.15
72 0.16
73 0.17
74 0.18
75 0.19
76 0.19
77 0.17
78 0.14
79 0.15
80 0.14
81 0.12
82 0.11
83 0.11
84 0.12
85 0.14
86 0.17
87 0.16
88 0.15
89 0.15
90 0.15
91 0.18
92 0.21
93 0.19
94 0.16
95 0.17
96 0.18
97 0.18
98 0.17
99 0.22
100 0.2
101 0.24
102 0.24
103 0.24
104 0.23
105 0.23
106 0.25
107 0.2
108 0.2
109 0.21
110 0.23
111 0.23
112 0.24
113 0.23
114 0.21
115 0.18
116 0.16
117 0.1
118 0.08
119 0.08
120 0.07
121 0.09
122 0.09
123 0.1
124 0.1
125 0.1
126 0.1
127 0.11
128 0.17
129 0.21
130 0.23
131 0.26
132 0.26
133 0.26
134 0.26
135 0.27
136 0.21
137 0.17
138 0.14
139 0.13
140 0.13
141 0.12
142 0.12
143 0.1
144 0.1
145 0.09
146 0.08
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.07
158 0.06
159 0.06
160 0.09
161 0.09
162 0.11
163 0.11
164 0.11
165 0.17
166 0.18
167 0.19
168 0.17
169 0.21
170 0.22
171 0.23
172 0.26
173 0.25
174 0.29
175 0.33
176 0.34
177 0.32
178 0.37
179 0.4
180 0.39
181 0.37
182 0.34
183 0.3
184 0.29
185 0.32
186 0.3
187 0.28
188 0.27
189 0.26
190 0.29
191 0.31
192 0.38
193 0.43
194 0.45
195 0.52
196 0.52
197 0.53
198 0.55
199 0.57
200 0.54
201 0.51
202 0.49
203 0.44
204 0.48
205 0.49
206 0.43
207 0.36
208 0.31
209 0.26
210 0.2
211 0.17
212 0.11
213 0.08
214 0.08
215 0.1
216 0.11
217 0.13
218 0.15
219 0.16
220 0.18
221 0.2
222 0.21
223 0.24
224 0.28
225 0.27
226 0.26
227 0.26
228 0.26
229 0.24
230 0.22
231 0.17
232 0.12
233 0.11
234 0.13
235 0.12
236 0.15
237 0.19
238 0.23
239 0.24
240 0.26
241 0.27
242 0.27
243 0.29
244 0.27
245 0.33
246 0.28
247 0.31
248 0.33
249 0.34
250 0.35
251 0.4
252 0.4
253 0.36
254 0.46
255 0.52
256 0.58
257 0.65
258 0.69
259 0.72
260 0.79
261 0.79
262 0.79
263 0.77
264 0.79
265 0.78
266 0.76
267 0.71
268 0.64
269 0.59
270 0.52
271 0.48
272 0.41
273 0.33
274 0.27