Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P25046

Protein Details
Accession P25046    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
183-204GSNSGNNSKKRKNKSSGSSMATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0070847  C:core mediator complex  
GO:0016592  C:mediator complex  
GO:0005634  C:nucleus  
GO:0003713  F:transcription coactivator activity  
GO:0003712  F:transcription coregulator activity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
GO:0006357  P:regulation of transcription by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
GO:0001113  P:transcription open complex formation at RNA polymerase II promoter  
KEGG sce:YBL093C  -  
Pfam View protein in Pfam  
PF08633  Rox3  
Amino Acid Sequences MASRVDETTVPSYYYYVDPETTYTYQQPNPLQDLISVYGLDDISRQVARTNLDGTKAVKLRKSYKNQIADLSGKFSTIPTRENGKGGQIAHILFQNNPDMMIQPPQQGQNMSEQQWREQLRNRDIALFQPPNFDWDLCSSVLSQFERSYPSEFANQNQGGAQAPFDIDDLAFDLDGTGKSQSGSNSGNNSKKRKNKSSGSSMATPTHSDSHEDMKRRRLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.17
5 0.16
6 0.18
7 0.23
8 0.23
9 0.24
10 0.25
11 0.28
12 0.29
13 0.35
14 0.38
15 0.36
16 0.38
17 0.37
18 0.33
19 0.29
20 0.29
21 0.25
22 0.21
23 0.17
24 0.13
25 0.13
26 0.13
27 0.12
28 0.09
29 0.07
30 0.09
31 0.1
32 0.1
33 0.1
34 0.13
35 0.14
36 0.16
37 0.19
38 0.18
39 0.2
40 0.22
41 0.22
42 0.26
43 0.29
44 0.29
45 0.29
46 0.34
47 0.41
48 0.48
49 0.55
50 0.58
51 0.63
52 0.68
53 0.66
54 0.62
55 0.58
56 0.52
57 0.44
58 0.38
59 0.29
60 0.21
61 0.2
62 0.18
63 0.18
64 0.15
65 0.16
66 0.15
67 0.21
68 0.22
69 0.24
70 0.24
71 0.21
72 0.23
73 0.22
74 0.21
75 0.17
76 0.16
77 0.15
78 0.16
79 0.15
80 0.12
81 0.13
82 0.12
83 0.1
84 0.1
85 0.09
86 0.08
87 0.08
88 0.12
89 0.12
90 0.12
91 0.14
92 0.14
93 0.15
94 0.15
95 0.15
96 0.18
97 0.19
98 0.19
99 0.21
100 0.2
101 0.2
102 0.26
103 0.27
104 0.23
105 0.27
106 0.32
107 0.34
108 0.38
109 0.37
110 0.33
111 0.32
112 0.32
113 0.33
114 0.28
115 0.24
116 0.23
117 0.22
118 0.22
119 0.23
120 0.21
121 0.14
122 0.14
123 0.16
124 0.13
125 0.13
126 0.12
127 0.12
128 0.15
129 0.15
130 0.14
131 0.12
132 0.13
133 0.16
134 0.17
135 0.19
136 0.17
137 0.18
138 0.23
139 0.24
140 0.24
141 0.3
142 0.28
143 0.25
144 0.24
145 0.23
146 0.18
147 0.17
148 0.16
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.05
155 0.05
156 0.07
157 0.07
158 0.06
159 0.06
160 0.06
161 0.06
162 0.07
163 0.08
164 0.07
165 0.07
166 0.08
167 0.1
168 0.1
169 0.14
170 0.17
171 0.2
172 0.26
173 0.34
174 0.41
175 0.47
176 0.55
177 0.6
178 0.66
179 0.73
180 0.76
181 0.78
182 0.8
183 0.81
184 0.83
185 0.82
186 0.79
187 0.74
188 0.68
189 0.62
190 0.54
191 0.47
192 0.4
193 0.35
194 0.3
195 0.28
196 0.27
197 0.33
198 0.38
199 0.44
200 0.46