Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7TF89

Protein Details
Accession A0A0F7TF89   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-111KRLCDGCKPVRRKNRVFIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MFSLRTVLGAPSALRQLLPSVSRRSIPGAMSLRPFSHMIRNSLTRLRATSSGTGSAVAVAVGATRQIEQVRGMKTRSSVKRLCDGCKPVRRKNRVFIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.16
5 0.18
6 0.21
7 0.24
8 0.26
9 0.28
10 0.28
11 0.31
12 0.3
13 0.27
14 0.31
15 0.28
16 0.29
17 0.3
18 0.31
19 0.27
20 0.26
21 0.27
22 0.2
23 0.25
24 0.26
25 0.26
26 0.28
27 0.3
28 0.31
29 0.33
30 0.33
31 0.26
32 0.24
33 0.23
34 0.21
35 0.21
36 0.2
37 0.18
38 0.17
39 0.16
40 0.15
41 0.13
42 0.11
43 0.08
44 0.06
45 0.04
46 0.03
47 0.03
48 0.02
49 0.03
50 0.03
51 0.03
52 0.05
53 0.05
54 0.06
55 0.09
56 0.14
57 0.17
58 0.19
59 0.2
60 0.2
61 0.23
62 0.32
63 0.36
64 0.39
65 0.4
66 0.41
67 0.48
68 0.51
69 0.51
70 0.5
71 0.52
72 0.54
73 0.6
74 0.65
75 0.66
76 0.73
77 0.79
78 0.77
79 0.79
80 0.8
81 0.78
82 0.76
83 0.75
84 0.74
85 0.73
86 0.76
87 0.74
88 0.74
89 0.76
90 0.81
91 0.83