Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7U057

Protein Details
Accession A0A0F7U057    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-47LTFTKYGKKDRKRPEVPVLGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15, nucl 13, cyto 13
Family & Domain DBs
Amino Acid Sequences MKTPGVTEVEIIYDRESESPLPKSAIDLTFTKYGKKDRKRPEVPVLGDGLDLEDPMVSHFADAGGRLAQDEKAALEPSNILNGVDRLRHKPLTPEICDDGGRNEDDLPSDVGDGVSGDFALQLAQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.13
5 0.17
6 0.19
7 0.2
8 0.21
9 0.2
10 0.21
11 0.24
12 0.23
13 0.22
14 0.2
15 0.22
16 0.27
17 0.28
18 0.28
19 0.27
20 0.35
21 0.42
22 0.5
23 0.57
24 0.61
25 0.71
26 0.75
27 0.8
28 0.8
29 0.79
30 0.71
31 0.63
32 0.54
33 0.43
34 0.36
35 0.28
36 0.19
37 0.1
38 0.08
39 0.05
40 0.04
41 0.03
42 0.04
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.09
66 0.09
67 0.07
68 0.07
69 0.08
70 0.09
71 0.13
72 0.15
73 0.18
74 0.23
75 0.24
76 0.25
77 0.29
78 0.37
79 0.41
80 0.42
81 0.43
82 0.41
83 0.41
84 0.41
85 0.36
86 0.3
87 0.24
88 0.22
89 0.18
90 0.15
91 0.13
92 0.14
93 0.15
94 0.14
95 0.12
96 0.12
97 0.11
98 0.1
99 0.1
100 0.09
101 0.07
102 0.06
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04