FuNGI

Q03697

Protein Details

Accession

Q03697

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
54-77	SGIYIKLRHKPVKNVLRKNNGFNW	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 14, mito 5, E.R. 4, golg 3

Family & Domain DBs

InterPro	View protein in InterPro IPR004853 Sugar_P_trans_dom
Gene Ontology	GO:0005801 C:cis-Golgi network GO:0030663 C:COPI-coated vesicle membrane GO:0005793 C:endoplasmic reticulum-Golgi intermediate compartment GO:0005794 C:Golgi apparatus GO:0000139 C:Golgi membrane GO:0015297 F:antiporter activity GO:0005338 F:nucleotide-sugar transmembrane transporter activity GO:0008643 P:carbohydrate transport GO:0015780 P:nucleotide-sugar transmembrane transport GO:0015786 P:UDP-glucose transmembrane transport
KEGG	sce:YML038C -
Pfam	View protein in Pfam PF03151 TPT

Amino Acid Sequences

MNRTVFLAFVFGWYFCSIALSIYNRWMFDPKDGLGIGYPVLVTTFHQATLWLLSGIYIKLRHKPVKNVLRKNNGFNWSFFLKFLLPTAVASAGDIGLSNVSFQYVPLTIYTIIKSSSIAFVLLFGCIFKLEKFHWKLALSVIIMFVGVALMVFKPSDSTSTKNDQALVIFGSFLVLASSCLSGLRWVYTQLMLRNNPIQTNTAAAVEESDGALFTENEDNVDNEPVVNLANNKMLENFGESKPHPIHTIHQLAPIMGITLLLTSLLVEKPFPGIFSSSIFRLDTSNGGVGTETTVLSIVRGIVLLILPGFAVFLLTICEFSILEQTPVLTVSIVGIVKELLTVIFGIIILSERLSGFYNWLGMLIIMADVCYYNYFRYKQDLLQKYHSVSTQDNRNELKGFQDFEQLGSKKIAPYSISVDLTNQEYELDMIAQNVSRSSQQV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.11
3	0.13
4	0.11
5	0.11
6	0.15
7	0.16
8	0.18
9	0.25
10	0.27
11	0.26
12	0.28
13	0.32
14	0.29
15	0.3
16	0.33
17	0.27
18	0.29
19	0.28
20	0.27
21	0.23
22	0.22
23	0.17
24	0.12
25	0.11
26	0.07
27	0.07
28	0.07
29	0.07
30	0.12
31	0.12
32	0.12
33	0.12
34	0.13
35	0.14
36	0.16
37	0.15
38	0.11
39	0.1
40	0.1
41	0.12
42	0.12
43	0.14
44	0.16
45	0.18
46	0.26
47	0.35
48	0.43
49	0.47
50	0.56
51	0.64
52	0.7
53	0.78
54	0.81
55	0.82
56	0.84
57	0.83
58	0.8
59	0.78
60	0.74
61	0.65
62	0.56
63	0.51
64	0.44
65	0.41
66	0.34
67	0.28
68	0.22
69	0.2
70	0.21
71	0.18
72	0.14
73	0.13
74	0.15
75	0.13
76	0.12
77	0.11
78	0.1
79	0.07
80	0.07
81	0.07
82	0.05
83	0.05
84	0.05
85	0.05
86	0.04
87	0.05
88	0.05
89	0.05
90	0.08
91	0.08
92	0.08
93	0.08
94	0.11
95	0.11
96	0.12
97	0.13
98	0.12
99	0.12
100	0.11
101	0.12
102	0.11
103	0.11
104	0.1
105	0.1
106	0.08
107	0.09
108	0.09
109	0.09
110	0.07
111	0.06
112	0.06
113	0.06
114	0.07
115	0.06
116	0.09
117	0.11
118	0.21
119	0.25
120	0.27
121	0.31
122	0.31
123	0.32
124	0.31
125	0.32
126	0.23
127	0.19
128	0.16
129	0.12
130	0.11
131	0.1
132	0.07
133	0.04
134	0.03
135	0.02
136	0.02
137	0.02
138	0.03
139	0.03
140	0.03
141	0.04
142	0.05
143	0.09
144	0.11
145	0.15
146	0.19
147	0.25
148	0.28
149	0.28
150	0.29
151	0.25
152	0.23
153	0.21
154	0.17
155	0.11
156	0.08
157	0.07
158	0.06
159	0.06
160	0.05
161	0.04
162	0.03
163	0.04
164	0.04
165	0.05
166	0.04
167	0.05
168	0.05
169	0.06
170	0.06
171	0.07
172	0.07
173	0.08
174	0.09
175	0.11
176	0.13
177	0.16
178	0.21
179	0.2
180	0.22
181	0.25
182	0.25
183	0.24
184	0.23
185	0.21
186	0.15
187	0.16
188	0.15
189	0.11
190	0.11
191	0.09
192	0.09
193	0.07
194	0.07
195	0.05
196	0.04
197	0.04
198	0.04
199	0.04
200	0.04
201	0.04
202	0.06
203	0.06
204	0.07
205	0.07
206	0.08
207	0.08
208	0.09
209	0.07
210	0.06
211	0.06
212	0.05
213	0.05
214	0.05
215	0.05
216	0.05
217	0.08
218	0.09
219	0.09
220	0.09
221	0.09
222	0.09
223	0.12
224	0.14
225	0.12
226	0.16
227	0.16
228	0.21
229	0.22
230	0.22
231	0.21
232	0.19
233	0.21
234	0.25
235	0.3
236	0.26
237	0.28
238	0.27
239	0.25
240	0.24
241	0.21
242	0.14
243	0.08
244	0.07
245	0.04
246	0.03
247	0.03
248	0.03
249	0.03
250	0.03
251	0.04
252	0.05
253	0.05
254	0.05
255	0.05
256	0.07
257	0.08
258	0.08
259	0.08
260	0.09
261	0.09
262	0.12
263	0.13
264	0.12
265	0.14
266	0.13
267	0.13
268	0.12
269	0.13
270	0.11
271	0.12
272	0.12
273	0.1
274	0.1
275	0.1
276	0.09
277	0.09
278	0.08
279	0.06
280	0.05
281	0.06
282	0.05
283	0.05
284	0.06
285	0.05
286	0.04
287	0.04
288	0.04
289	0.04
290	0.04
291	0.04
292	0.04
293	0.04
294	0.03
295	0.03
296	0.03
297	0.03
298	0.03
299	0.03
300	0.03
301	0.05
302	0.05
303	0.05
304	0.05
305	0.06
306	0.06
307	0.07
308	0.12
309	0.11
310	0.11
311	0.11
312	0.11
313	0.11
314	0.11
315	0.11
316	0.06
317	0.05
318	0.05
319	0.08
320	0.08
321	0.08
322	0.07
323	0.07
324	0.07
325	0.07
326	0.07
327	0.04
328	0.04
329	0.04
330	0.04
331	0.04
332	0.04
333	0.04
334	0.04
335	0.05
336	0.04
337	0.05
338	0.05
339	0.05
340	0.07
341	0.09
342	0.09
343	0.1
344	0.11
345	0.12
346	0.11
347	0.11
348	0.1
349	0.08
350	0.08
351	0.06
352	0.05
353	0.04
354	0.04
355	0.04
356	0.04
357	0.05
358	0.06
359	0.07
360	0.1
361	0.15
362	0.18
363	0.2
364	0.26
365	0.29
366	0.34
367	0.44
368	0.5
369	0.51
370	0.56
371	0.59
372	0.55
373	0.55
374	0.51
375	0.44
376	0.41
377	0.41
378	0.43
379	0.43
380	0.47
381	0.46
382	0.47
383	0.45
384	0.4
385	0.39
386	0.34
387	0.32
388	0.27
389	0.32
390	0.3
391	0.3
392	0.39
393	0.33
394	0.31
395	0.31
396	0.32
397	0.27
398	0.29
399	0.3
400	0.22
401	0.25
402	0.29
403	0.32
404	0.32
405	0.29
406	0.29
407	0.28
408	0.29
409	0.26
410	0.2
411	0.14
412	0.13
413	0.13
414	0.12
415	0.11
416	0.09
417	0.09
418	0.1
419	0.12
420	0.12
421	0.12
422	0.13

Q03697

3D AlphaFold-predicted Structure Viewer