Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q03697

Protein Details
Accession Q03697   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-77SGIYIKLRHKPVKNVLRKNNGFNWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 5, E.R. 4, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004853  Sugar_P_trans_dom  
Gene Ontology GO:0005801  C:cis-Golgi network  
GO:0030663  C:COPI-coated vesicle membrane  
GO:0005793  C:endoplasmic reticulum-Golgi intermediate compartment  
GO:0005794  C:Golgi apparatus  
GO:0000139  C:Golgi membrane  
GO:0015297  F:antiporter activity  
GO:0005338  F:nucleotide-sugar transmembrane transporter activity  
GO:0008643  P:carbohydrate transport  
GO:0015780  P:nucleotide-sugar transmembrane transport  
GO:0015786  P:UDP-glucose transmembrane transport  
KEGG sce:YML038C  -  
Pfam View protein in Pfam  
PF03151  TPT  
Amino Acid Sequences MNRTVFLAFVFGWYFCSIALSIYNRWMFDPKDGLGIGYPVLVTTFHQATLWLLSGIYIKLRHKPVKNVLRKNNGFNWSFFLKFLLPTAVASAGDIGLSNVSFQYVPLTIYTIIKSSSIAFVLLFGCIFKLEKFHWKLALSVIIMFVGVALMVFKPSDSTSTKNDQALVIFGSFLVLASSCLSGLRWVYTQLMLRNNPIQTNTAAAVEESDGALFTENEDNVDNEPVVNLANNKMLENFGESKPHPIHTIHQLAPIMGITLLLTSLLVEKPFPGIFSSSIFRLDTSNGGVGTETTVLSIVRGIVLLILPGFAVFLLTICEFSILEQTPVLTVSIVGIVKELLTVIFGIIILSERLSGFYNWLGMLIIMADVCYYNYFRYKQDLLQKYHSVSTQDNRNELKGFQDFEQLGSKKIAPYSISVDLTNQEYELDMIAQNVSRSSQQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.13
4 0.11
5 0.11
6 0.15
7 0.16
8 0.18
9 0.25
10 0.27
11 0.26
12 0.28
13 0.32
14 0.29
15 0.3
16 0.33
17 0.27
18 0.29
19 0.28
20 0.27
21 0.23
22 0.22
23 0.17
24 0.12
25 0.11
26 0.07
27 0.07
28 0.07
29 0.07
30 0.12
31 0.12
32 0.12
33 0.12
34 0.13
35 0.14
36 0.16
37 0.15
38 0.11
39 0.1
40 0.1
41 0.12
42 0.12
43 0.14
44 0.16
45 0.18
46 0.26
47 0.35
48 0.43
49 0.47
50 0.56
51 0.64
52 0.7
53 0.78
54 0.81
55 0.82
56 0.84
57 0.83
58 0.8
59 0.78
60 0.74
61 0.65
62 0.56
63 0.51
64 0.44
65 0.41
66 0.34
67 0.28
68 0.22
69 0.2
70 0.21
71 0.18
72 0.14
73 0.13
74 0.15
75 0.13
76 0.12
77 0.11
78 0.1
79 0.07
80 0.07
81 0.07
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.05
89 0.05
90 0.08
91 0.08
92 0.08
93 0.08
94 0.11
95 0.11
96 0.12
97 0.13
98 0.12
99 0.12
100 0.11
101 0.12
102 0.11
103 0.11
104 0.1
105 0.1
106 0.08
107 0.09
108 0.09
109 0.09
110 0.07
111 0.06
112 0.06
113 0.06
114 0.07
115 0.06
116 0.09
117 0.11
118 0.21
119 0.25
120 0.27
121 0.31
122 0.31
123 0.32
124 0.31
125 0.32
126 0.23
127 0.19
128 0.16
129 0.12
130 0.11
131 0.1
132 0.07
133 0.04
134 0.03
135 0.02
136 0.02
137 0.02
138 0.03
139 0.03
140 0.03
141 0.04
142 0.05
143 0.09
144 0.11
145 0.15
146 0.19
147 0.25
148 0.28
149 0.28
150 0.29
151 0.25
152 0.23
153 0.21
154 0.17
155 0.11
156 0.08
157 0.07
158 0.06
159 0.06
160 0.05
161 0.04
162 0.03
163 0.04
164 0.04
165 0.05
166 0.04
167 0.05
168 0.05
169 0.06
170 0.06
171 0.07
172 0.07
173 0.08
174 0.09
175 0.11
176 0.13
177 0.16
178 0.21
179 0.2
180 0.22
181 0.25
182 0.25
183 0.24
184 0.23
185 0.21
186 0.15
187 0.16
188 0.15
189 0.11
190 0.11
191 0.09
192 0.09
193 0.07
194 0.07
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.06
203 0.06
204 0.07
205 0.07
206 0.08
207 0.08
208 0.09
209 0.07
210 0.06
211 0.06
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.08
218 0.09
219 0.09
220 0.09
221 0.09
222 0.09
223 0.12
224 0.14
225 0.12
226 0.16
227 0.16
228 0.21
229 0.22
230 0.22
231 0.21
232 0.19
233 0.21
234 0.25
235 0.3
236 0.26
237 0.28
238 0.27
239 0.25
240 0.24
241 0.21
242 0.14
243 0.08
244 0.07
245 0.04
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.04
252 0.05
253 0.05
254 0.05
255 0.05
256 0.07
257 0.08
258 0.08
259 0.08
260 0.09
261 0.09
262 0.12
263 0.13
264 0.12
265 0.14
266 0.13
267 0.13
268 0.12
269 0.13
270 0.11
271 0.12
272 0.12
273 0.1
274 0.1
275 0.1
276 0.09
277 0.09
278 0.08
279 0.06
280 0.05
281 0.06
282 0.05
283 0.05
284 0.06
285 0.05
286 0.04
287 0.04
288 0.04
289 0.04
290 0.04
291 0.04
292 0.04
293 0.04
294 0.03
295 0.03
296 0.03
297 0.03
298 0.03
299 0.03
300 0.03
301 0.05
302 0.05
303 0.05
304 0.05
305 0.06
306 0.06
307 0.07
308 0.12
309 0.11
310 0.11
311 0.11
312 0.11
313 0.11
314 0.11
315 0.11
316 0.06
317 0.05
318 0.05
319 0.08
320 0.08
321 0.08
322 0.07
323 0.07
324 0.07
325 0.07
326 0.07
327 0.04
328 0.04
329 0.04
330 0.04
331 0.04
332 0.04
333 0.04
334 0.04
335 0.05
336 0.04
337 0.05
338 0.05
339 0.05
340 0.07
341 0.09
342 0.09
343 0.1
344 0.11
345 0.12
346 0.11
347 0.11
348 0.1
349 0.08
350 0.08
351 0.06
352 0.05
353 0.04
354 0.04
355 0.04
356 0.04
357 0.05
358 0.06
359 0.07
360 0.1
361 0.15
362 0.18
363 0.2
364 0.26
365 0.29
366 0.34
367 0.44
368 0.5
369 0.51
370 0.56
371 0.59
372 0.55
373 0.55
374 0.51
375 0.44
376 0.41
377 0.41
378 0.43
379 0.43
380 0.47
381 0.46
382 0.47
383 0.45
384 0.4
385 0.39
386 0.34
387 0.32
388 0.27
389 0.32
390 0.3
391 0.3
392 0.39
393 0.33
394 0.31
395 0.31
396 0.32
397 0.27
398 0.29
399 0.3
400 0.22
401 0.25
402 0.29
403 0.32
404 0.32
405 0.29
406 0.29
407 0.28
408 0.29
409 0.26
410 0.2
411 0.14
412 0.13
413 0.13
414 0.12
415 0.11
416 0.09
417 0.09
418 0.1
419 0.12
420 0.12
421 0.12
422 0.13