Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TBM9

Protein Details
Accession A0A0A1TBM9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
174-199ASAMRVRGKRSSPRRKMPLRAPPTNCHydrophilic
NLS Segment(s)
PositionSequence
179-191VRGKRSSPRRKMP
Subcellular Location(s) extr 11, nucl 4, mito 4, mito_nucl 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015366  S53_propep  
Gene Ontology GO:0008236  F:serine-type peptidase activity  
Pfam View protein in Pfam  
PF09286  Pro-kuma_activ  
CDD cd11377  Pro-peptidase_S53  
Amino Acid Sequences MKIAAIFLSAFVTAALGVPMGTSVVHEKRSQLPSHLSKRSAESDVVVPVRIALKQRNLDKGMDLIMDVSDPESKNSGKHYTQEQIVELFKPSEDYVNTVRDWLVKAGIPADQITLPNSQSCLGFHTTVRQLSKMLNTEYNFYVDSETDNEHFGTEQYALPATIADHADFITPGASAMRVRGKRSSPRRKMPLRAPPTNCASLYKDLKQVVYVMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.11
11 0.14
12 0.17
13 0.19
14 0.22
15 0.3
16 0.36
17 0.36
18 0.35
19 0.41
20 0.48
21 0.56
22 0.59
23 0.53
24 0.5
25 0.53
26 0.52
27 0.46
28 0.37
29 0.3
30 0.26
31 0.29
32 0.27
33 0.22
34 0.18
35 0.16
36 0.16
37 0.16
38 0.17
39 0.17
40 0.23
41 0.3
42 0.34
43 0.4
44 0.41
45 0.4
46 0.38
47 0.34
48 0.28
49 0.22
50 0.17
51 0.11
52 0.08
53 0.07
54 0.06
55 0.06
56 0.08
57 0.08
58 0.09
59 0.11
60 0.11
61 0.13
62 0.17
63 0.22
64 0.2
65 0.23
66 0.26
67 0.28
68 0.3
69 0.3
70 0.26
71 0.23
72 0.22
73 0.2
74 0.16
75 0.13
76 0.1
77 0.1
78 0.1
79 0.1
80 0.09
81 0.11
82 0.13
83 0.15
84 0.15
85 0.14
86 0.14
87 0.13
88 0.14
89 0.11
90 0.1
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.07
97 0.08
98 0.07
99 0.07
100 0.08
101 0.09
102 0.09
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.1
109 0.11
110 0.12
111 0.12
112 0.16
113 0.18
114 0.21
115 0.22
116 0.2
117 0.18
118 0.19
119 0.23
120 0.22
121 0.21
122 0.22
123 0.22
124 0.24
125 0.24
126 0.24
127 0.21
128 0.18
129 0.16
130 0.12
131 0.12
132 0.11
133 0.12
134 0.11
135 0.12
136 0.12
137 0.11
138 0.11
139 0.1
140 0.09
141 0.09
142 0.09
143 0.08
144 0.09
145 0.09
146 0.08
147 0.08
148 0.07
149 0.09
150 0.09
151 0.08
152 0.08
153 0.09
154 0.09
155 0.09
156 0.09
157 0.06
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.1
164 0.19
165 0.21
166 0.25
167 0.31
168 0.38
169 0.47
170 0.59
171 0.66
172 0.68
173 0.76
174 0.83
175 0.86
176 0.88
177 0.88
178 0.88
179 0.85
180 0.85
181 0.8
182 0.76
183 0.73
184 0.69
185 0.59
186 0.53
187 0.48
188 0.47
189 0.48
190 0.46
191 0.46
192 0.44
193 0.43
194 0.4