Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53833

Protein Details
Accession P53833    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SGSLKSLDKKIAKRRQVYKPVLDNPFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 11.333, cyto_nucl 9.333, mito 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0005829  C:cytosol  
GO:0005655  C:nucleolar ribonuclease P complex  
GO:0005634  C:nucleus  
GO:0000172  C:ribonuclease MRP complex  
GO:0034965  P:intronic box C/D RNA processing  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0000294  P:nuclear-transcribed mRNA catabolic process, RNase MRP-dependent  
GO:0090502  P:RNA phosphodiester bond hydrolysis, endonucleolytic  
GO:0006364  P:rRNA processing  
GO:0001682  P:tRNA 5'-leader removal  
GO:0008033  P:tRNA processing  
KEGG sce:YNL282W  -  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQSKENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVKLVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVKLLKTTVPIVSKKRQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.82
4 0.86
5 0.85
6 0.83
7 0.82
8 0.82
9 0.78
10 0.71
11 0.61
12 0.56
13 0.55
14 0.46
15 0.37
16 0.29
17 0.26
18 0.28
19 0.31
20 0.26
21 0.21
22 0.27
23 0.3
24 0.32
25 0.31
26 0.26
27 0.3
28 0.35
29 0.36
30 0.31
31 0.26
32 0.24
33 0.24
34 0.26
35 0.17
36 0.13
37 0.12
38 0.17
39 0.16
40 0.16
41 0.19
42 0.2
43 0.25
44 0.25
45 0.26
46 0.24
47 0.3
48 0.32
49 0.29
50 0.27
51 0.23
52 0.21
53 0.21
54 0.2
55 0.15
56 0.16
57 0.17
58 0.16
59 0.15
60 0.14
61 0.12
62 0.11
63 0.1
64 0.08
65 0.04
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.12
81 0.13
82 0.14
83 0.15
84 0.15
85 0.15
86 0.17
87 0.16
88 0.11
89 0.11
90 0.11
91 0.09
92 0.08
93 0.09
94 0.07
95 0.07
96 0.07
97 0.06
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.08
105 0.1
106 0.11
107 0.12
108 0.15
109 0.16
110 0.18
111 0.18
112 0.17
113 0.18
114 0.19
115 0.18
116 0.16
117 0.16
118 0.16
119 0.2
120 0.21
121 0.18
122 0.17
123 0.17
124 0.16
125 0.16
126 0.2
127 0.16
128 0.15
129 0.17
130 0.19
131 0.19
132 0.2
133 0.21
134 0.23
135 0.27
136 0.31
137 0.3
138 0.29
139 0.34
140 0.4
141 0.46
142 0.44
143 0.47
144 0.48
145 0.52
146 0.5
147 0.48
148 0.43
149 0.34
150 0.29
151 0.3
152 0.24
153 0.19
154 0.24
155 0.22
156 0.22
157 0.24
158 0.27
159 0.27
160 0.29
161 0.34
162 0.32
163 0.34
164 0.41
165 0.47
166 0.52
167 0.5
168 0.51
169 0.49
170 0.5
171 0.49
172 0.46
173 0.45
174 0.43
175 0.45