Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TDG0

Protein Details
Accession A0A0A1TDG0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPSNRVSYRRRNPYNTTSNRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MPSNRVSYRRRNPYNTTSNRTRVIKTPGGKLRVLHIKKRGTVPKCGDCGSKLIGVPALRPREYANISKPKKTVQRAYGGSRCGGCVRDRIVRAFLIEEQKIVKKVLKEQEASQKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.78
4 0.75
5 0.72
6 0.71
7 0.67
8 0.6
9 0.55
10 0.54
11 0.53
12 0.49
13 0.53
14 0.53
15 0.53
16 0.52
17 0.46
18 0.45
19 0.48
20 0.49
21 0.46
22 0.47
23 0.48
24 0.5
25 0.58
26 0.6
27 0.52
28 0.57
29 0.57
30 0.55
31 0.53
32 0.51
33 0.44
34 0.36
35 0.35
36 0.28
37 0.23
38 0.16
39 0.14
40 0.15
41 0.13
42 0.15
43 0.18
44 0.19
45 0.17
46 0.18
47 0.19
48 0.21
49 0.24
50 0.26
51 0.28
52 0.35
53 0.38
54 0.41
55 0.41
56 0.43
57 0.48
58 0.51
59 0.51
60 0.46
61 0.53
62 0.54
63 0.6
64 0.58
65 0.51
66 0.46
67 0.38
68 0.34
69 0.27
70 0.25
71 0.18
72 0.18
73 0.21
74 0.26
75 0.28
76 0.29
77 0.3
78 0.29
79 0.28
80 0.26
81 0.27
82 0.26
83 0.24
84 0.23
85 0.24
86 0.27
87 0.28
88 0.27
89 0.27
90 0.24
91 0.33
92 0.41
93 0.45
94 0.44
95 0.49
96 0.58