Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1TC21

Protein Details
Accession A0A0A1TC21    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-37TAEEKRLKEDRERKKYWKKWGPYVSERBasic
NLS Segment(s)
PositionSequence
21-25RERKK
Subcellular Location(s) cyto 11.5, cyto_nucl 9.5, nucl 6.5, mito 3, pero 3
Family & Domain DBs
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MVVFDGHEYLTAEEKRLKEDRERKKYWKKWGPYVSERQWATVREDYSPDGDAWSHFPHEHARSRAFRWGEDGIAGVCDTHGWENIGFSFWNEKDEFLKERLFGLSNPQGNHGESIKEAHFHLDNTPTVLSIHLAIRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.33
4 0.35
5 0.39
6 0.49
7 0.58
8 0.63
9 0.7
10 0.75
11 0.81
12 0.86
13 0.86
14 0.86
15 0.82
16 0.83
17 0.83
18 0.82
19 0.78
20 0.8
21 0.74
22 0.72
23 0.64
24 0.57
25 0.51
26 0.44
27 0.42
28 0.37
29 0.32
30 0.26
31 0.27
32 0.25
33 0.23
34 0.23
35 0.17
36 0.13
37 0.12
38 0.11
39 0.12
40 0.12
41 0.12
42 0.11
43 0.12
44 0.16
45 0.21
46 0.26
47 0.26
48 0.3
49 0.31
50 0.33
51 0.39
52 0.34
53 0.3
54 0.28
55 0.26
56 0.21
57 0.18
58 0.16
59 0.1
60 0.09
61 0.09
62 0.05
63 0.04
64 0.03
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.06
71 0.07
72 0.08
73 0.07
74 0.07
75 0.12
76 0.11
77 0.14
78 0.14
79 0.15
80 0.16
81 0.2
82 0.22
83 0.19
84 0.21
85 0.18
86 0.19
87 0.2
88 0.19
89 0.16
90 0.21
91 0.26
92 0.28
93 0.28
94 0.3
95 0.3
96 0.3
97 0.32
98 0.25
99 0.2
100 0.17
101 0.2
102 0.17
103 0.17
104 0.16
105 0.17
106 0.18
107 0.17
108 0.2
109 0.21
110 0.21
111 0.22
112 0.22
113 0.19
114 0.18
115 0.17
116 0.15
117 0.13