Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CJE6

Protein Details
Accession Q6CJE6   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
249-269DPDLNRRTKRLYKNVASRSYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5mito_nucl 13.5, mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031455  Gep5  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0000002  P:mitochondrial genome maintenance  
KEGG kla:KLLA0_F19228g  -  
Pfam View protein in Pfam  
PF17053  GEP5  
Amino Acid Sequences MKASLLRTSKLYKGLHSITKDAISKVDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFLKTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYLFKDGKFEISELARGGFVLSKENLSENLAAALEEEHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.48
4 0.47
5 0.42
6 0.45
7 0.44
8 0.37
9 0.33
10 0.28
11 0.28
12 0.28
13 0.35
14 0.35
15 0.38
16 0.45
17 0.53
18 0.58
19 0.59
20 0.61
21 0.61
22 0.66
23 0.69
24 0.71
25 0.7
26 0.67
27 0.65
28 0.61
29 0.6
30 0.53
31 0.51
32 0.5
33 0.45
34 0.43
35 0.47
36 0.51
37 0.44
38 0.44
39 0.45
40 0.43
41 0.42
42 0.41
43 0.4
44 0.38
45 0.41
46 0.39
47 0.35
48 0.28
49 0.25
50 0.28
51 0.31
52 0.35
53 0.33
54 0.33
55 0.32
56 0.31
57 0.33
58 0.28
59 0.27
60 0.27
61 0.34
62 0.4
63 0.38
64 0.38
65 0.4
66 0.44
67 0.39
68 0.33
69 0.26
70 0.22
71 0.23
72 0.23
73 0.24
74 0.21
75 0.24
76 0.25
77 0.26
78 0.22
79 0.21
80 0.21
81 0.16
82 0.16
83 0.12
84 0.1
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.07
91 0.07
92 0.11
93 0.13
94 0.16
95 0.2
96 0.26
97 0.29
98 0.35
99 0.37
100 0.32
101 0.3
102 0.28
103 0.27
104 0.24
105 0.23
106 0.17
107 0.25
108 0.26
109 0.25
110 0.3
111 0.29
112 0.28
113 0.36
114 0.46
115 0.46
116 0.56
117 0.66
118 0.69
119 0.78
120 0.79
121 0.75
122 0.71
123 0.65
124 0.58
125 0.48
126 0.39
127 0.3
128 0.26
129 0.2
130 0.14
131 0.1
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.06
144 0.07
145 0.07
146 0.07
147 0.08
148 0.09
149 0.1
150 0.11
151 0.11
152 0.12
153 0.15
154 0.2
155 0.23
156 0.28
157 0.28
158 0.28
159 0.3
160 0.32
161 0.29
162 0.27
163 0.25
164 0.22
165 0.2
166 0.21
167 0.26
168 0.24
169 0.27
170 0.27
171 0.31
172 0.33
173 0.34
174 0.43
175 0.4
176 0.46
177 0.46
178 0.47
179 0.46
180 0.43
181 0.45
182 0.36
183 0.33
184 0.27
185 0.23
186 0.21
187 0.18
188 0.16
189 0.13
190 0.11
191 0.09
192 0.07
193 0.08
194 0.07
195 0.06
196 0.08
197 0.08
198 0.09
199 0.1
200 0.1
201 0.12
202 0.16
203 0.21
204 0.22
205 0.25
206 0.29
207 0.34
208 0.37
209 0.4
210 0.4
211 0.38
212 0.4
213 0.4
214 0.37
215 0.33
216 0.3
217 0.24
218 0.21
219 0.17
220 0.14
221 0.13
222 0.11
223 0.12
224 0.13
225 0.14
226 0.13
227 0.12
228 0.11
229 0.1
230 0.09
231 0.08
232 0.07
233 0.07
234 0.08
235 0.08
236 0.09
237 0.18
238 0.22
239 0.27
240 0.29
241 0.33
242 0.4
243 0.5
244 0.58
245 0.6
246 0.67
247 0.7
248 0.78
249 0.83
250 0.82
251 0.77
252 0.69
253 0.66
254 0.6
255 0.59
256 0.51
257 0.43
258 0.42
259 0.41
260 0.43
261 0.37
262 0.33
263 0.28
264 0.28
265 0.29
266 0.23
267 0.21
268 0.16
269 0.15
270 0.15
271 0.14
272 0.12
273 0.15
274 0.15
275 0.16
276 0.17
277 0.19
278 0.19
279 0.19
280 0.19
281 0.15
282 0.16
283 0.14
284 0.13
285 0.12