Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40577

Protein Details
Accession P40577    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-72DSLDRFIRRKKSRVVKYIPSLSAHydrophilic
103-122QYKSRLPKIRKLGWNRFKPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008402  APC_su15/mnd2  
IPR016807  Mnd2  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0005634  C:nucleus  
GO:1990948  F:ubiquitin ligase inhibitor activity  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0051301  P:cell division  
GO:1902426  P:deactivation of mitotic spindle assembly checkpoint  
GO:0000070  P:mitotic sister chromatid segregation  
GO:1905785  P:negative regulation of anaphase-promoting complex-dependent catabolic process  
GO:1902499  P:positive regulation of protein autoubiquitination  
GO:0016567  P:protein ubiquitination  
GO:0007131  P:reciprocal meiotic recombination  
GO:0051445  P:regulation of meiotic cell cycle  
GO:0007346  P:regulation of mitotic cell cycle  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
KEGG sce:YIR025W  -  
Pfam View protein in Pfam  
PF05841  Apc15p  
Amino Acid Sequences MARALRDISLFNDIRKDQNSAGAKHERYNMRDLRSKKNQHVNGIDDYEDDSLDRFIRRKKSRVVKYIPSLSAYNVFNEFPYYPTSASQLLDGKLDEFLMLSEQYKSRLPKIRKLGWNRFKPIGINKTMYELEMLRSRARAQNAEGNNEEDFRQHDSREEDPRNNGSIGRVILPHILQENEEYDTGEGVTGLHSMPNDSMAILANNSANNSQNEEVSEEDEISYDYDAEFDHVVDEDDNEEGEVPGEGVEGIEVQRERIVPDDLLMRPTSLSRSLQQFVEEAHHLDRNPYDIDSDNDGEDSKVELDMNPDFEDDVGREHDYNSEYSQEPTSYGGITPDLASNWRNWTRERITSLDELMERRARQQRGQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.38
4 0.3
5 0.38
6 0.43
7 0.38
8 0.44
9 0.48
10 0.47
11 0.48
12 0.55
13 0.53
14 0.5
15 0.57
16 0.56
17 0.54
18 0.6
19 0.6
20 0.62
21 0.66
22 0.71
23 0.71
24 0.76
25 0.75
26 0.76
27 0.77
28 0.72
29 0.66
30 0.6
31 0.5
32 0.4
33 0.36
34 0.27
35 0.21
36 0.16
37 0.11
38 0.1
39 0.12
40 0.14
41 0.16
42 0.23
43 0.34
44 0.41
45 0.48
46 0.57
47 0.66
48 0.73
49 0.79
50 0.8
51 0.79
52 0.8
53 0.81
54 0.72
55 0.65
56 0.55
57 0.47
58 0.44
59 0.35
60 0.29
61 0.22
62 0.21
63 0.18
64 0.19
65 0.18
66 0.14
67 0.16
68 0.16
69 0.15
70 0.16
71 0.18
72 0.17
73 0.17
74 0.19
75 0.19
76 0.17
77 0.18
78 0.17
79 0.15
80 0.13
81 0.13
82 0.1
83 0.07
84 0.06
85 0.06
86 0.07
87 0.07
88 0.09
89 0.1
90 0.12
91 0.16
92 0.19
93 0.25
94 0.33
95 0.37
96 0.44
97 0.53
98 0.6
99 0.64
100 0.72
101 0.76
102 0.77
103 0.81
104 0.77
105 0.71
106 0.63
107 0.59
108 0.57
109 0.53
110 0.47
111 0.41
112 0.36
113 0.37
114 0.36
115 0.32
116 0.25
117 0.18
118 0.16
119 0.17
120 0.19
121 0.15
122 0.16
123 0.18
124 0.21
125 0.23
126 0.23
127 0.21
128 0.28
129 0.29
130 0.32
131 0.3
132 0.28
133 0.26
134 0.24
135 0.22
136 0.14
137 0.14
138 0.16
139 0.16
140 0.14
141 0.17
142 0.2
143 0.25
144 0.33
145 0.36
146 0.33
147 0.35
148 0.37
149 0.36
150 0.33
151 0.29
152 0.2
153 0.19
154 0.17
155 0.14
156 0.12
157 0.1
158 0.11
159 0.11
160 0.11
161 0.09
162 0.09
163 0.08
164 0.08
165 0.09
166 0.09
167 0.09
168 0.08
169 0.07
170 0.07
171 0.07
172 0.06
173 0.05
174 0.03
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.05
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.09
195 0.09
196 0.12
197 0.12
198 0.12
199 0.12
200 0.13
201 0.12
202 0.11
203 0.11
204 0.08
205 0.08
206 0.07
207 0.07
208 0.06
209 0.06
210 0.05
211 0.04
212 0.04
213 0.04
214 0.06
215 0.05
216 0.05
217 0.05
218 0.05
219 0.06
220 0.06
221 0.06
222 0.06
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.03
235 0.03
236 0.03
237 0.03
238 0.06
239 0.06
240 0.07
241 0.08
242 0.09
243 0.09
244 0.11
245 0.13
246 0.11
247 0.12
248 0.16
249 0.16
250 0.17
251 0.17
252 0.15
253 0.14
254 0.15
255 0.16
256 0.15
257 0.16
258 0.18
259 0.23
260 0.25
261 0.25
262 0.26
263 0.24
264 0.21
265 0.23
266 0.2
267 0.17
268 0.17
269 0.19
270 0.18
271 0.2
272 0.19
273 0.18
274 0.18
275 0.17
276 0.16
277 0.16
278 0.18
279 0.21
280 0.22
281 0.19
282 0.18
283 0.18
284 0.16
285 0.15
286 0.13
287 0.09
288 0.08
289 0.09
290 0.09
291 0.12
292 0.13
293 0.15
294 0.14
295 0.14
296 0.13
297 0.13
298 0.14
299 0.11
300 0.12
301 0.12
302 0.14
303 0.14
304 0.14
305 0.18
306 0.18
307 0.2
308 0.19
309 0.2
310 0.19
311 0.21
312 0.23
313 0.19
314 0.18
315 0.18
316 0.18
317 0.15
318 0.15
319 0.14
320 0.12
321 0.12
322 0.13
323 0.12
324 0.12
325 0.14
326 0.14
327 0.16
328 0.24
329 0.29
330 0.31
331 0.32
332 0.41
333 0.45
334 0.51
335 0.54
336 0.49
337 0.48
338 0.49
339 0.48
340 0.43
341 0.39
342 0.34
343 0.35
344 0.36
345 0.32
346 0.37
347 0.44
348 0.45