Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A1SII4

Protein Details
Accession A0A0A1SII4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPASGKKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-19GKKKKWSKGKVKDK
Subcellular Location(s) mito 14.5, mito_nucl 12.833, nucl 10, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPASGKKKKWSKGKVKDKAQHAVILDKATSEKLYKDVQSYRLVTVATLVDRMKVNGSLARQCLADLEEKGMIKPVVTHSKMKIYTRAVASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.91
4 0.89
5 0.86
6 0.83
7 0.73
8 0.66
9 0.56
10 0.49
11 0.4
12 0.34
13 0.26
14 0.19
15 0.17
16 0.14
17 0.14
18 0.11
19 0.1
20 0.12
21 0.15
22 0.16
23 0.19
24 0.21
25 0.24
26 0.28
27 0.28
28 0.26
29 0.24
30 0.23
31 0.18
32 0.16
33 0.13
34 0.09
35 0.09
36 0.08
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.1
43 0.11
44 0.13
45 0.15
46 0.16
47 0.17
48 0.16
49 0.15
50 0.15
51 0.14
52 0.15
53 0.12
54 0.13
55 0.15
56 0.15
57 0.15
58 0.17
59 0.16
60 0.13
61 0.14
62 0.19
63 0.26
64 0.29
65 0.33
66 0.33
67 0.42
68 0.48
69 0.49
70 0.5
71 0.45
72 0.48